SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010172 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010172
Domain Number 1 Region: 544-636
Classification Level Classification E-value
Superfamily DEATH domain 2.09e-21
Family DEATH domain, DD 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010172   Gene: ENSMGAG00000009811   Transcript: ENSMGAT00000011018
Sequence length 642
Comment pep:known_by_projection chromosome:UMD2:3:51606944:51626783:1 gene:ENSMGAG00000009811 transcript:ENSMGAT00000011018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STREALHHKTLKPLLNAFNQIPGSENEKKCTLDQAFRVIVEEEIINKAPCENLLAIISLA
INGVTEGICTASTPFVLLGDVLDCLPLDQCDKIFTFVEKNVATWKSNMFYSAGKNYLLRM
CNEYLDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNTNEHES
TLGQKHSEERDEGMDVEEGEMGDDEAPTSCSIPIDYNLYRKFWSLQDYFRNPVQCYEKVS
WKTFLKYSEEVLAVFKSYKLDDTQASRKKLEELKTGGEHVYFAKFLTSEKLMDLQLSDSN
FRRHILLQYLILFQYLKGQVKFKSSNYVLTDEQSLWIEDTTKAVYQLLSENPPDGERFSK
MVEHILNTEENWNSWKNEGCPSFVKERPPDSKPMRPARKRPAPEDFLGKGPNKKILMGNE
ELTRLWNLCPDNMEACKSESREYMPTLEEFFEEAIEQADPENMVENKYKAVNNSNYGWRA
LRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLK
ENNESPEVQRDKPMTGEQMEAFAIRLGEHWRALAPYLEMKDSDIRQIEADSDDVKMRAKQ
LLVAWQDQEGAHSTPENLITALSKAGLGDLAESLTNDTDTGS
Download sequence
Identical sequences G1NBW9
ENSMGAP00000010172 ENSMGAP00000010172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]