SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010184 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010184
Domain Number 1 Region: 1649-1747
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000000000419
Family Plakin repeat 0.01
Further Details:      
 
Domain Number 2 Region: 690-801
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000158
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 3 Region: 97-212
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000589
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 4 Region: 319-390
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000096
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010184   Gene: ENSMGAG00000009827   Transcript: ENSMGAT00000011030
Sequence length 1749
Comment pep:known_by_projection chromosome:UMD2:16:13891732:13911811:-1 gene:ENSMGAG00000009827 transcript:ENSMGAT00000011030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSLFRKRNKGKYSPSVQKKSISSKELTELIERLQKNADQVEKNIVETDSRMQNDLHKIK
ACQLAQYKELTAQKLTESDKLLYVLDGDAAVARHMKHPQGDMITEDIRQLKERVANLRVK
HDQIYNFPLQHIEPQVNWCTVIEEKQDALCGKGFGTDLPLVNSQVEEHNIFHNEVMAIGP
HITKEGNKGYTSDLQAKFQKLLASSQQRQQDLNSLQDYMQRCTNKLYWLDQQAKDRTHYD
WSDHNLDYPSRRRQYEVGARSHLSLLPQFPFIKHLEVYSQLKVGRAGKRGLNNPAGQKHA
PWHLAGAVPAARIPLVRDSAFLQFQKDAKDAQQLLKKVDTDLDQKYSPEFKDRYQLESLL
RELDDQEKALEKYDAVVQSLQERSQHILPLRYRRLPPPQPIPVEALCEYEGEQGQITRGA
HYTLQKNSGDIWEVMDGAGGAISAPGVCFMIPPPDAEAIALADQIADSYVAVKEKTSNCK
NILQQRYEGLKADSIGDAASVQGRQLLAGLEKVHSDLDKLEKAITANLRPPLEQSRAVQD
STERSKDLKNITNEVRRIEPEKMRKVQDCEAFIESVPNTGSATLVKNKVENTNKKYDRVV
QLLSAAQEKVEVATHLEKSLQQGRDLLSTYENKLVTDDTVPEDLRVIDSKKEELLAMGSE
LQSKRFLLNEAEQNLLRTKTCSNTLASKFQEHCPDIERQEAELYKLNQRFNNLSKQIDHR
TQTLQKAKSAYSNYRTNYDKINQFLCNIPNYEPQETDNIQQVEVKLKNQTALLGDIASKE
QEVQKVSATAQQYQQAVKDYELEAEKLRSILDLENGRNGYISKKPRLQSPAAKVKEEEAI
LAAKFTEVNAVNRQRLQNLEFAQSLLRQQQQPEVQVTQDFIQTKKSVRPVEEVWKLKKEL
EDETQRRQQLEAEIQAIQNNIVQLQNQKPQETVVKKELVKKVPDPQLEESFHKLQQSLAE
EQRKNQVLQDELEALKIRLRVLEHEKKEGGQEYIVKEVLRIEQDKAQAEEILRLKEELEE
LRRQEGTRENEVILLRQQIAVLSSEKNKEQEKVTEKEVLKLQNDPQLEMEFRMLQENKQR
ESALRQKYEEELSFLQEKLKRLEKERAIAEGKITVKEVLKVEKDVAIEREVNELRRQYED
EKSRGRSNEREKAELLRKIQLLEEENAKVVVQEKVREIVRPDPKAENEVANLRLELVEQE
RRYRGGDEQLKSCQNELAALRNREPLVEVKEVIKEVIKYKNDPETEKELQRLREEIIERT
GAIERADLEIYQLKQEIQALKDTKPQVHTKEVVQEILQFREDPKTREEVESLRVQLAEEQ
MKHVDLERERLLQEEKVRQKEEELSQVKEKVVQQEVVKYEQDPALKAEVNSFSQSIESEL
KQIDSLREELRKLQRRRSELERQLEELEKERQARREAELEVQRLRIRLNELEEQERETTE
RVTVKQKVILQQDPQQEKEHSLLRLELEEEKHRRQVLQTELEALRKKLLSLEKMEVKEKV
VFSESVQVDKGDTEYEIQKLKSNLEEESRRKRELDADINRLETRLSEVEFNNSKSSKELD
LLREENHKLHLEKQNLLMETRRLQSEIELTATEARDLRNMTHADSGPNLDSRFQALEREL
DDLKQLSREKDAEIEQLQNRLKTXNHLRRSIVVIDPDTGKEMSPEEAHVLGLIEWSLFVK
LKSQECDWEEISIKGPNGESSVILDRKSGREFSIENALKSGRLSTTQYNSYLNKQMSIQE
LAVLVSGSD
Download sequence
Identical sequences G1NBX9
ENSMGAP00000010184 ENSMGAP00000010184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]