SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010240 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010240
Domain Number 1 Region: 44-383
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-86
Family Protein kinases, catalytic subunit 0.00000221
Further Details:      
 
Domain Number 2 Region: 918-984
Classification Level Classification E-value
Superfamily G protein-binding domain 3.4e-23
Family RhoA-binding domain 0.00011
Further Details:      
 
Domain Number 3 Region: 1111-1198,1277-1311
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000286
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 4 Region: 1217-1274
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000959
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 
Domain Number 5 Region: 395-498
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000016
Family Myosin rod fragments 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010240   Gene: ENSMGAG00000009863   Transcript: ENSMGAT00000011087
Sequence length 1345
Comment pep:known_by_projection chromosome:UMD2:3:51663992:51709971:-1 gene:ENSMGAG00000009863 transcript:ENSMGAT00000011087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQDGLDALVYELDFPALRKNKNIDNFLNRYKDTVNKMRDLRMKAEDYEVVKVIGRGAFGE
VQLVRHKSSRRVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYL
YMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKA
GHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLY
EMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNEISKEAKNLICAFLTDREVRLGRNGV
EEIKRHLFFKDDQWAWETLRDTVAPVVPDLSSDIDTSNFDDIDEDKGEEETFPIPKAFVG
NQLPFVGFTYYSNRRYVQTKNSNDNRTGSSMDKSVMENMQKMIYDLEEQLHNEMQLKDEM
EQKCRSSNITLDKIMKELDEEGNQRKNLELTVSQIEKEKMALQHKINDYQRKIEQESEKR
RNVENEVSTLKDQMEDLKKISQHSQITNEKITQLQKQLEEANDLLRTESETAVRLRKGNT
EMSKSLSQVESLNRELQERCRVLESAKLQVEKDYYQLQAALESERRDRSHGSEMIGELQV
RITTLQEELKNLKNNLERVEAERKQAQDRLNHSEKEKNNLEIDLNYKLKSLQDRLEQEVN
EHKVTKARLTDKHQSIEEAKSVAMCEMEKKVKEERAAREKAENRIVQAEKQCSMLDFDLK
QSQQKLEHLLQQKERLEDEVKNLSLQLEQETNKRIMAQNELKAQAFEADNLKGSEKQLKQ
EINTLLEAKRLLEVELAQLAKQYRGNEGQMRELQDQLEAEQYFSTLYKTQVKELKEEIDE
KNKETQRKMQELQNEKETLTTQLDLAETKAESEQLARALLEEQYFELSQESKKAASRHRQ
EMTDKDSIIRRLEETNSTLTKDVDLITKENSEISEKMKKQEEEYKMKKEEEINNIRMQYE
KSINTERTLKTQAVNKLAEIMNRKDFKIDRKKASMQDLRKKDKENRKLQLELNQEKEKFN
QMVVKYQKELNEMQAQLAEESTYRNELQMQLDSKESDIEQLRRKILDLQQGMDSTSVSSL
QPDEIDGNLSVDSSCIPYLFISYAYLLLESRLEGWLSIPNKGNIKRHGWKKQYVVVSSKK
ILFYNDEKDKDQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILYANEGECRKD
VEVESVQPAEKTNFLNHKGHEFIPTIYHFPANCEACAKPLWHVFKPPAALECRRCHVKCH
RDHLDKKEELIAPCKVSYDVTSARDMLLLASCQDEQKKWVTHLVKKIPKNPPSTFVRASP
RTMSTRSSANQSFRKAVKNTSGKTR
Download sequence
Identical sequences G1NC22
ENSMGAP00000010240 ENSMGAP00000010240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]