SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010259 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010259
Domain Number 1 Region: 191-212,415-646
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.15e-38
Family FolH catalytic domain-like 0.00058
Further Details:      
 
Domain Number 2 Region: 219-433
Classification Level Classification E-value
Superfamily PA domain 6.41e-26
Family PA domain 0.0029
Further Details:      
 
Domain Number 3 Region: 648-778
Classification Level Classification E-value
Superfamily Transferrin receptor-like dimerisation domain 0.0000000000000011
Family Transferrin receptor-like dimerisation domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010259   Gene: ENSMGAG00000009912   Transcript: ENSMGAT00000011108
Sequence length 795
Comment pep:known_by_projection chromosome:UMD2:11:18380042:18576520:-1 gene:ENSMGAG00000009912 transcript:ENSMGAT00000011108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEENGTPLMQSVKNVKKMAYHKVNADQRTQGQYLDSDDLQATALELEWDMEKELEEPGFD
HFRLDGAVQHHLGNSQSPDLDLEPIQPSASPKGRFQRLQEDPEYISHYSRQSPKSHRCXF
FQILKVFCAALILFIFGIVIGYYAGKKCPSPPASPNLTNPSLYKDLLKAVKAENFKINFR
NMEDLLKSPREDDVDAAMKILLQWTSHGLEDVRLVNYSVLLDLPDSSSNTITLKNSGECF
YPDGQQCSKVTKTLHSQDLLYSYAAYSAKGTLEDEKKSAVYGLCSSTASSKNIRNVTENV
SMIKQAPIPTVIKLSLLEDAGFGGVLLYVDPCDLPKTTDLADKAFMVSLNSGGDPSTPGY
ASIDGNYRQHRLNLTTLLVQPISASLAKKLAFIPENRVQKDKCVPVQMSSTDKKIISLSI
QSITTYKTISNVIGYLKGSVFPDRYVIIGSHHSSLNAYDGQEWASSTAIITAFIQALMLK
VKRGWRTDRTIVFCSWGGTSFGNIGSYEWAEDLKRVLQRNVVAYVSLHNPVRGNSTLHPI
ASPSLQQLATESQSINCVEKTECPGSNVSSVQTQGDSDYFINHLGVPALLFSYEDINTSE
NASFLSEALFPMHAMRTEELDPSFKLHENIAKFSGHATLQIANEPVLPFNALDIALEVQN
SLRGEEVDASQLLAVASRLRDTAELFQSDEMRPANDPRERAPIRVRMLNDVLQSLEKSFL
VQQAPPGLYRNILYRLDERTSQFSVLLEALEHCKLHQSNETIQAALSEVLNSISSAQVYF
KAGLDVFETTLAGKK
Download sequence
Identical sequences G1NC35
ENSMGAP00000010259 ENSMGAP00000010259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]