SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010339 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010339
Domain Number 1 Region: 1-138
Classification Level Classification E-value
Superfamily DEATH domain 1.58e-29
Family DEATH domain, DD 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010339   Gene: ENSMGAG00000009995   Transcript: ENSMGAT00000011193
Sequence length 196
Comment pep:known_by_projection chromosome:UMD2:5:17954374:17955956:1 gene:ENSMGAG00000009995 transcript:ENSMGAT00000011193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFLALLNSLSACLSDSELRDLKFLCQDKIGKRKLESVQSFRELCNFLMEQQLISRHNV
DLLKSMFKSIKREDLILRLEHFIEEEEASAPDEWPDMKERRLQKVVIEVICENVGRDWKK
LMRKLDLSEVKIERIEVAKPRDLQEQLAQSLREWQKFKGKDAKVTDLIKALRDCNMNLVA
DIAEQKLSRLNTENMQ
Download sequence
Identical sequences G1NC91
ENSMGAP00000010339 ENSMGAP00000010339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]