SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010430 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010430
Domain Number 1 Region: 53-237
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.72e-79
Family T-box 0.000000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010430   Gene: ENSMGAG00000010075   Transcript: ENSMGAT00000011288
Sequence length 521
Comment pep:known_by_projection chromosome:UMD2:17:12780260:12813059:1 gene:ENSMGAG00000010075 transcript:ENSMGAT00000011288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADTEEGFGLPSTPADSEAKELQAEAKQDPQLGTTSKAPTSPQAAFTQQGMEGIKVFLHE
RELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNK
WSVTGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQ
PRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKITQLKIENNPFAKGFRGSD
DMELHRMSRMQSKEYPVVPRSTVRQKVSSNHSPFSGETRVLSTSSNLGSQYQCENGVSST
SQDLLPPANPYPISQEHSQIYHCTKRKDEECSTTEHPYKKPYMETSPAEEDPFYRSSYPQ
QQGLNTSYRTESAQRQACMYASSAPPTDPVPSLEDISCNTWPSMPSYSSCTVSAMQPMDR
LPYQHFSAHFTSGPLMPRLSSVANHTSPQIGDTHSMFQHQTSVSHQPIVRQCGPQTGIQS
PPSSLQPAEFLYSHPVPRTLSPHQYHSVHGVGMVPEWSENS
Download sequence
Identical sequences G1NCF9
ENSMGAP00000010430 ENSMGAP00000010430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]