SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010448 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010448
Domain Number 1 Region: 11-185
Classification Level Classification E-value
Superfamily RUN domain-like 2.35e-40
Family RUN domain 0.00073
Further Details:      
 
Domain Number 2 Region: 471-578
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-16
Family Pleckstrin-homology domain (PH domain) 0.0065
Further Details:      
 
Domain Number 3 Region: 631-719
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000385
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010448   Gene: ENSMGAG00000010092   Transcript: ENSMGAT00000011306
Sequence length 904
Comment pep:novel chromosome:UMD2:29:861422:871262:-1 gene:ENSMGAG00000010092 transcript:ENSMGAT00000011306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSSHADDPKEVIQLIKKQLVSSIKALQKQYVSSDAVVTSDDGNANTLCSALEAVFVHGL
KAKHIRTETGGKGRKAGGRLPLPQPVFWALLKSITHRNIISELEQLIFITTDVGRCRAWL
RLALNDGLVECYLKLLLRERSRLPEFYQPAALLLDAEECEFLLSFLQGLSSLTFQLSYKS
AVLNEWTVTPLSLSGLCPVSELLEPPTDEPQRKASLGSISQSSGSDEIEIQPSALPIGKA
GDKPKRTSSSLSLNTTGSSQLSSSLGSDSVQPHCARSPERGDEPLSCDSDLGTATAEDLD
RSLQEVLSEFRKAEPSFGAPSERLIPAVLGCSPPPPEDTHPPPSPPPAEACTAPQEEDSI
PAPQHVDGGKEGRVVRSPAAKLLCSPLPGCPNRKSWISEDDFYRPSAGESDEIPADANGF
VPDGAGEGLTSGLLSALDLERPSPPSSQGPRLSPEREQKGFSVVHRRQMGLSNPFRGLLK
LGSLERRGAMGIWKEFSCELSPLELRLFLDHEDRICVESFSLLRCESLALTHSDGRFELV
FLGKKLCLRAPSRDEAEDWLDRIREALRKCRPQLEEEEWETLEYPEDGGDGCEPCAPLQY
EAPGNGLDWTLSHKPELDAIKESVLYADVDKTWVPFIFSLSLETLKCFKVRNNDKILSNS
YGIETIQDILPDTSLGGPSFFKVITSKAVLKLQAESAQEAAAWRELVRAVLGSYLEAAEE
ALTLGGSLDGHSQVLLKSMVKENGFLLQYLVAIPMEKGLDSQSFICAGCSRQIGFSFAKP
KLCAYSGLYYCDSCHRDDEVVIPSRLIHNWDLSKRGVCRQALKFLTQIRKQPLIDLKLVN
ESLYDHVERMRRIRRSREQLKLLGDYLSVCRSGALKELSKRLDHRNYLLECPHKYSVADL
QQVS
Download sequence
Identical sequences G1NCH3
ENSMGAP00000010448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]