SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010462 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010462
Domain Number 1 Region: 91-212
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000072
Family Armadillo repeat 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010462   Gene: ENSMGAG00000010110   Transcript: ENSMGAT00000011320
Sequence length 213
Comment pep:known_by_projection chromosome:UMD2:10:21587157:21589129:1 gene:ENSMGAG00000010110 transcript:ENSMGAT00000011320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSVKEQEAIRKLMIFLQEWDNAHKAARSHILDNFIRSNNGKTEPELELEFSQGASLFLA
RLAAWLRMTYMYSTCINKLLKSIGVFLSAASGRRYIIEFLEIGGVLMLLEILGLNHLKEE
DKRESVKLLQLIADAGRKYKELICESYGVRSLAELLATCSSAEAQEEVQILLASLGRGNP
KYQNQVYSGLLAVLPHGSPHAQQLALQTLHSMQ
Download sequence
Identical sequences G1NCI4
ENSMGAP00000010462 ENSMGAP00000010462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]