SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010581 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010581
Domain Number 1 Region: 164-418
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.84e-51
Family Protein kinases, catalytic subunit 0.0006
Further Details:      
 
Domain Number 2 Region: 1-69
Classification Level Classification E-value
Superfamily DEATH domain 5.47e-17
Family DEATH domain, DD 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010581   Gene: ENSMGAG00000010194   Transcript: ENSMGAT00000011442
Sequence length 644
Comment pep:known_by_projection chromosome:UMD2:14:20327707:20338717:1 gene:ENSMGAG00000010194 transcript:ENSMGAT00000011442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASYVITDQTELRKIKCMEKTGISITRELMWWWGVRLATVRQLLELLQALQLYRAAQVILD
WISPSSITTSEKEELVDSPKQENVSLTPTENKHKERENEISLLPSPEPSQPGISPACNAV
SGGTLYSLPSPPPPPRDLLKSLQSNPSVSSSVKPCSSSPPQQETMTDLPSGSLLWTQKEV
TNATDGFSDKSRICEGTFADVYKGQRHNMVYVIKRLKETECTSPNSTQRFFHTEVQICFR
CCHVNILQLLGFTVESELHCLIYPYLPNGSLQNKLQHQDDSAPLAWETRISISVGLIRAV
EYLHNFGILHGNIKSSNVLLDENFTPKLGHSGLRLYSADKKSKYTVMKTKVLQASLTYLP
EDFVRHGQLTEKVDVFGCGVVLAEILTGIKALDEGRSPIYLKDMIADEIQLAKEKSHSKV
KNLEKLAAKEICCKYLDKKAGHLLEEVAIDFASAICLCLRKKNSNIAEVLEITETAENKL
REHYICGGSTSGFSVNTPEETDDETTNLSMDAPSAGQNKEDSTQPVLLASGGQCTPSVGV
VPPDAHCLQMSRVPCESDESMSFIWNPEEKSTDELFSNNCNNSENTPSSDCRIKEKTKAN
GLRERNVVCIRSDDNLEMAATAQSTFQSKNADLDSACSSQGKCR
Download sequence
Identical sequences G1NCS5
ENSMGAP00000010581 ENSMGAP00000010581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]