SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010603 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010603
Domain Number 1 Region: 220-541
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-89
Family Protein kinases, catalytic subunit 0.0000000659
Further Details:      
 
Domain Number 2 Region: 1-73
Classification Level Classification E-value
Superfamily CAD & PB1 domains 5.1e-22
Family PB1 domain 0.00000921
Further Details:      
 
Domain Number 3 Region: 89-160
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.5e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010603   Gene: ENSMGAG00000010216   Transcript: ENSMGAT00000011464
Sequence length 564
Comment pep:known_by_projection chromosome:UMD2:11:19912453:19927586:-1 gene:ENSMGAG00000010216 transcript:ENSMGAT00000011464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DIMITYFEPSISFEGLCSEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYE
LNKDSELLIHVFPCVPERPGMPCPGEDKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHC
AICSDRIWGLGRQGYKCINCKLLVHKKCHKLVNSECGRHTLQPEPIMPMDPSSVHPDNVE
SALVIPYNPSSHESLDHVGEEKEAMGIRESGKASSSLGLQDFDLLRVIGRGSYAKVLLVR
LKKTERIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVI
EYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHI
KLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSP
FDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKAAGVLKSFLNKDPKERLGCHPQTG
FADIQGHPFFRNVDWDLMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLTPDDDDIVK
KIDQSEFEGFEYINPLLMSAEECV
Download sequence
Identical sequences G1NCU1
ENSMGAP00000010603 ENSMGAP00000010603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]