SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010669 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010669
Domain Number 1 Region: 277-591
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-93
Family Protein kinases, catalytic subunit 0.00000000984
Further Details:      
 
Domain Number 2 Region: 103-163
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.36e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00038
Further Details:      
 
Domain Number 3 Region: 15-88
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.54e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010669   Gene: ENSMGAG00000010280   Transcript: ENSMGAT00000011530
Sequence length 610
Comment pep:known_by_projection chromosome:UMD2:2:26696760:26797443:1 gene:ENSMGAG00000010280 transcript:ENSMGAT00000011530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSVSAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQPTYCSHCRDFIWGV
IGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETHDEQVGSQRFSVNMPHKFSIHNYKV
PTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIAKVLADLGVTPDK
ITNSGQRRKKLIAGAENQQPVPGSTSSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNR
GEEHRATATTSADNQLNKPGENGENGEVKQAQTKRIGLEEFNFIKVLGKGSFGKVMLAEL
KGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVME
YVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCK
LADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPF
EADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPNKRLGCVASQNGEDAIKQHPF
FKEIDWVLLEQRKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDETIIKQINQEEFKG
FSYFGEELLP
Download sequence
Identical sequences G1NCZ2
ENSMGAP00000010669 ENSMGAP00000010669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]