SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010689 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010689
Domain Number 1 Region: 205-529
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.65e-75
Family Protein kinases, catalytic subunit 0.0000000000115
Further Details:      
 
Domain Number 2 Region: 30-184
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.19e-39
Family Regulator of G-protein signaling, RGS 0.000000123
Further Details:      
 
Domain Number 3 Region: 554-666
Classification Level Classification E-value
Superfamily PH domain-like 7.12e-26
Family Pleckstrin-homology domain (PH domain) 0.00000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010689   Gene: ENSMGAG00000010262   Transcript: ENSMGAT00000011550
Sequence length 687
Comment pep:known_by_projection chromosome:UMD2:13:1759559:1764762:-1 gene:ENSMGAG00000010262 transcript:ENSMGAT00000011550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLEAVLADVSYLMAMEKSRAAPAARASKRILLPEPSIRSVMQKYLEDRGEVTFDKIFA
QKIGYLLFRDFALNHAEEAKPLMEFYEEIKKYEKLDSEEERATRSHHIFDHYIMKELLAC
SHPFSKSATEHVQSRLSKKEVPPDLFQPYIEEICQNLRGRIFQKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIXXXXXXXXYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNERI
MLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEAEMRFYASEI
ILGLEHMHSRFVVYRDLKPANILLDEFGHVRISDLGLACDFSKKKPHASVGTHGYMAPEV
LQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPEL
RSLLEGLLQRDVNQRLGCMGRGAQEVKEEPFFKGLDWQMVFLQKYSPPLIPPRGEVNAAD
AFDIGSFDEEDTKGIKLLESDQELYRNFPLTISERWQQEVTETVFDTVNADTDKQEARKK
AKNKQLGHEEDYAMGKDCIVHGYMSKLGNPFLTQWQRRYFYLFPNRLEWRGEGESPQSLL
TMEEIDSVEETQVKERKCILLRIRGGKQFVLQCDSDPELVQWQKELRDAQRQAQQLLQRV
PRMQNKPRSPVVELSKVPFLQRSANGL
Download sequence
Identical sequences G1ND07
ENSMGAP00000010689 ENSMGAP00000010689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]