SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010746 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010746
Domain Number 1 Region: 1014-1139,1337-1494
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.31e-36
Family p120GAP domain-like 0.022
Further Details:      
 
Domain Number 2 Region: 6-114
Classification Level Classification E-value
Superfamily Sema domain 1.83e-23
Family Sema domain 0.0088
Further Details:      
 
Domain Number 3 Region: 573-663
Classification Level Classification E-value
Superfamily E set domains 2.93e-16
Family Other IPT/TIG domains 0.094
Further Details:      
 
Domain Number 4 Region: 117-169
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000106
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 5 Region: 662-709
Classification Level Classification E-value
Superfamily E set domains 0.0000344
Family E-set domains of sugar-utilizing enzymes 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010746   Gene: ENSMGAG00000010317   Transcript: ENSMGAT00000011609
Sequence length 1557
Comment pep:known_by_projection chromosome:UMD2:14:20417701:20467614:-1 gene:ENSMGAG00000010317 transcript:ENSMGAT00000011609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CISLQLQPEQLDCGAAHLQHPLAIVNPITATPILTYNGLTAVAVTSINNYTVVFLGTASG
GLLKINLDSAMRVVSRRSISVAYGEPVHPIMQFDPSDPTYLYLMTSYQMTRVKVAACEQY
STCAECLAAADAYCGWCTMETRCSLQHECMNFTEANFWASASEGVQQCPSMTILEPEINI
DKENPVLIIQINGTIPNLNGTNISCNYGNNIHTVARVAGDYANQFIYCSLLPRQKYPAFP
EDQDHVTVETALQVNSKNIIQANFTIYDCKRTGNIYPKRACTSCLSTRWKCYWCPSRYMC
VSNRSWCEDALQMRWCSEPYLSSSRAPCARCPGCSAPPDLSPANMAPHAAFSACNLHLGH
SIPSSYHWVSKKGQEILLPLWMLEVAGEEAIPHCSVHIFYFFELQRADAHTPLAEGFGLE
RKHNLWHWLMKSVVEVYNCATGSADCSQCLGREDLGHRCVWSESSSSCRLSTESPQPSDV
CPAPEIKKVRLGGVRGRAGAGCAVLGWELCCSPGTRFLRIQYVSISPPCGEKCCTNLLAR
RIVCRTGAAQQVFADVVTVNVSREGKSRERYSYMLPLVRSIAPQNGPKAGGTRVTIRGSW
LDVGSELRVLVNSSPCLSLCSRNDSTITCTMPSAELTTAVRVCVQFENRSCASYNITFKY
EKNPVVTDINPKKSQISGGRIITLEGRGFELVQNASMVVRAIGTSSAWSTTLTPSSSQPR
RRSGSSTTLGAACYSLGSPKEQCSICLQXDAEVQSSRSWRCPLRHEAQKAAFHVIARSED
ILTACNVLHRHSPRLRPCSRIPSMSPLVYILPPQKEPDNLGLESSEYQVKIGLISCEIQI
VSVLVRHCEPPGRIEKRGNSSGNKSFLIACGGVVMSHSCILMHGSLAAEVCLTQQAQPAA
GACWRVLAAELECLEQLYSKKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTD
LTKELNRSQGIPFLEYKHFVTRTFFPKAGGSPFSPKSSAPGKQSGCRPNMEEGISLFSTL
LNNKHFLIIFVHALEQQKDFAVRDRCNLASLLTIALHGKLEYYTSIMKDLLVDLIDASAS
KNPKLMLRRTESVVEKMLTNWMSICMYSYLRETVGEPFFLLICAIKQQINKGSIDAITGK
ARYTLNEEWLLRENIEAKPRTVSSWRDSWAGAAPGPHSSPRCPGHIPLSAGSAPQEPPLP
LGCSQKQVPASRLPAQLCPPHTEWFATSTDSYILRDLDDTSVVEDGRKKLNTLAHYKIPE
GASLAMSLSVWLLSVLRRSTLQRLPINSNSRSVVTGARKALALWDIIKNYQEPQLQPHRS
TSQRPERQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIRDDKPPVAVKYFFDFL
EEQAEKRGITDPDTMHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQAFID
ACSLSDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDMPPLSEQEMNAHLAEESRKY
RNEFNTNVAMAEIYKYAKRYRSQIVAALDSNPTTKRTQLQHKFEQVIALMEDNIYEC
Download sequence
Identical sequences G1ND52
ENSMGAP00000010746 ENSMGAP00000010746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]