SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010936 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010936
Domain Number 1 Region: 358-540
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-45
Family BCR-homology GTPase activation domain (BH-domain) 0.0000993
Further Details:      
 
Domain Number 2 Region: 279-336
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000227
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000010936
Domain Number - Region: 32-102
Classification Level Classification E-value
Superfamily Tropomyosin 0.017
Family Tropomyosin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010936   Gene: ENSMGAG00000010511   Transcript: ENSMGAT00000011803
Sequence length 608
Comment pep:known_by_projection scaffold:UMD2:GL429722.1:81235:87068:-1 gene:ENSMGAG00000010511 transcript:ENSMGAT00000011803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTTMRNLWNLCDQLIRQAEVLSEGNEYQFIQLAKNFEDYRRKWQKTEQELGRYKDLLMK
SEAERSALDVKLKHARNQVDVEIKRRQKAEADCEKLERQIQLIRELLMCDASGSIQLSEE
QKSALAFLNRPQVSVGGSGNKRLSTIDESGSILSDISFDKTDDSLDWDSSAVKAVRLKRR
EKRRSSRQYAEGPPAPEKKIRSIGSTADQGNESIVAKTTLMVPSDGGPIEAISTIQTVPY
GLRSQRKSGPLQPWSSETSLGSKQVEFKPESNGSGTPQSNGGVRLHDFVSKTVIKPESCV
PCGKRVKFGKISLKCRDCHVVSHPECRDRCPLPCIPTLTGPPVKIGEGTLMDFVPSAPPM
IPSIIVHCVNEIEQRGLHEKGLYRISGCDKTVRELKEKFLRSKNIPLLSNVDDIHAICGL
LKDFLRNLKEPLLTFRLNKTFMEAAEISDEDNSVAAMYQAVGELPRANRDTLAFLMVHLQ
RNRVAQSPDTKMDVTNLAKVFGPTIVAHAVPDPDPMTLLQDTKRQPKVVERLLLLPMEYW
SQLMMVEQENVDPAHVIENTNAYSTPQTPDVKECIFEPLTTPERQMYRRLSSSSLCQKVL
STFSMTPK
Download sequence
Identical sequences H9H1S0
ENSMGAP00000010936 ENSMGAP00000010936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]