SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010953 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010953
Domain Number 1 Region: 13-310
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.31e-83
Family Pancreatic carboxypeptidases 0.0000000157
Further Details:      
 
Domain Number 2 Region: 311-393
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 6.47e-22
Family Carboxypeptidase regulatory domain 0.0000597
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010953   Gene: ENSMGAG00000010537   Transcript: ENSMGAT00000011821
Sequence length 437
Comment pep:known_by_projection chromosome:UMD2:1:37064355:37096072:-1 gene:ENSMGAG00000010537 transcript:ENSMGAT00000011821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAVGVLCLVSLVSALDYKYHHSEELEAYLKEVHAAHPALTHLHSIGRSVEGRDLWVLVLG
RFPTQHKIGIPEFKYVANMHGDETVGREILLHLIDHLVTSYGRDPAITRLLNNTRIHIMP
TMNPDGFEATVVPDCYYSRGRYNKNGEDLNRNFPDAFENNNNIIQPETQAVINWIKNETF
VLSANLHGGALVASYTFDNGNSVTGTSNGYSRSPDDDVFVHLAKTYSFNHASMYKGTGCD
SRQTFPDGITNGYSWYQLEGGMQDYNYVWGQCFEITLELSCCKYPPAEQLEKFWRDNKVA
LVEYIKQVHLGVKGQVTDKNGNPIPNAIVEAKGRPHICPYRTNEHGEYFLLLLPGKYVIN
ATVPGFKSMLKTVDVPDNTANFSALKQDFSFPEVSVKPRPASCPRTPLYQELERSSAAVK
PTLHMLVLVMVTISIFK
Download sequence
Identical sequences G1NDL5
ENSMGAP00000010953 ENSMGAP00000010953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]