SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011021 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011021
Domain Number 1 Region: 218-404
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.0000000000000323
Family DNA-binding domain from NDT80 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011021   Gene: ENSMGAG00000010606   Transcript: ENSMGAT00000011889
Sequence length 907
Comment pep:known_by_projection chromosome:UMD2:1:37337032:37382226:1 gene:ENSMGAG00000010606 transcript:ENSMGAT00000011889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVVGENEALQQFFEEQDVHRALENPMVDTSMLEEFLSSDLEFGTLQRQLPDSPPDSGSE
AYSPPQLKIATWGDATLPSGQQSPFPCPSAVAPSKLPYRFLETSSDPNSSGHPCSIPQGC
CMKRDNAVTPWNNSTSSNSLGFNYSYFQPNVSQISSTPAASGIKRKLSQLLGDTTDPQVW
CNNSSQAVLKDCAAEVQEYDSDGQNAALEKCCQALTWQLYQASQWNSLVNSNYEKLPAIG
YHIVTDKGFNFSATDDAFVCQKKNHFQITVHIRITGHPKYVKTQLGVKPIEKFYLKAFGI
RMEAPNQTIAIEQSQSDRSKKTFYPVRVDLPGDQITKVTLGRLHFSETTANNMRKKGKPN
PDQRYFMLVVGLYAVSQDQFYLLSANISEKIIVRASNPGQFENDSDVLWQRGQVPETVVC
HGRVGINTDAPDEALVVCGNAKVMGRVMHPSDSRAKENIREVDTNEQLKRITQMRLVEYN
YKPEFASVMGIENTHETGIIAQEVKELLPQAVREAGDVAFNNGEKIENFLMVDKDQIFME
NVGAVKQLCKLTNNLEVRIEELEQWNRKLARLKRLSSLKSTVSERSTVSRCSRVTSLLPS
RKSVQLKSSKVCISKRNGSCSRKIFRVTILALVAVMALCALTISTLYILSIHDKYLEKHV
VSSSNTSSSVVLFPSTTTAALQESTISQSTQTINGIPEVNFCDLLPCDKVYCCPIHQAVV
KYRSYEETNSGETRKLKKRVEREDKNKPILTSSFFLLPTWGTERIDTTIRSIQILETQQL
IDSRYCSKNLQCRSGNYSCIIPISKYSPINVEISLEINTTEPLIIFLCKITFGNYCSYYS
SSRNSGKNFQETTQGRQHIWTLPVARLYDSAYYFRVAAPGLVSCSTDPYYAGIFFTDYYF
YFYRKCN
Download sequence
Identical sequences G1NDS1
ENSMGAP00000011021 ENSMGAP00000011021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]