SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011098 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011098
Domain Number 1 Region: 4-117
Classification Level Classification E-value
Superfamily PH domain-like 2.44e-37
Family Pleckstrin-homology domain (PH domain) 0.00000151
Further Details:      
 
Domain Number 2 Region: 179-244
Classification Level Classification E-value
Superfamily SH3-domain 7.88e-16
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011098   Gene: ENSMGAG00000010680   Transcript: ENSMGAT00000011967
Sequence length 245
Comment pep:known_by_projection chromosome:UMD2:6:32793159:32836668:-1 gene:ENSMGAG00000010680 transcript:ENSMGAT00000011967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNQFPPIAAQDLQFVLKAGYLEKRRKDHSFLGFEWQKRWCAISKTVFYYYGSDKDKQQKG
EFALEGYTIRMNNSLRKDAKKDCCFEISAPDKRIYQFTAATPKEAEEWVQQVKFVIQDME
SNTIPEEEEEYDDVGHASSEPIDDSIYEELPVNQKENAPPKTEMPKKWSQEKVDAASDGK
NTDYANFYQGLWDCTGDVPDELTFKRGDVIYILSKEYNRFGWWVGEMKGTIGLVPKAYIM
EMYDI
Download sequence
Identical sequences G1NDY4
ENSMGAP00000011098 ENSMGAP00000011098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]