SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011187 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011187
Domain Number 1 Region: 274-468
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.51e-59
Family BCR-homology GTPase activation domain (BH-domain) 0.00000000814
Further Details:      
 
Domain Number 2 Region: 24-160
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-27
Family SH2 domain 0.0000001
Further Details:      
 
Domain Number 3 Region: 206-268
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.21e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000447
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011187   Gene: ENSMGAG00000010748   Transcript: ENSMGAT00000012057
Sequence length 468
Comment pep:known_by_projection chromosome:UMD2:6:34176767:34272043:1 gene:ENSMGAG00000010748 transcript:ENSMGAT00000012057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVKSCTSSLVSAGISGYAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKYYGREF
HGIISREQADEILAGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLFYDGKHFVGEKRF
ESIHDLVTDGLITLYIETKASEYISKMTTNPIYEHIGYATLLREKVSRRLSRTKNESRKA
SVTSEENTPVEKITSLVRRAALTQNDNHFNYEKAHNFKVHTFRGPHWCEYCANFMWGLIA
QGVRCSDCGLNVHKQCSKYVPNDCQPDLKRIKRVYCCDLTTLVKAHNTQRPMVVDSCIRE
IEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGDKADISASIYPDINIIAGALKLYFRDLP
IPVITYDTYSKFIEAAKISNPDERLEAIHEVLMLLPAAHYETLRYLMIHLKKVTLHEKEN
FMNAENLGIVFGPTLMRPPEDSTLATLNDMRYQKLIVQILIENEDVLF
Download sequence
Identical sequences G1NE59
ENSMGAP00000011187 ENSMGAP00000011187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]