SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011231 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011231
Domain Number 1 Region: 331-524
Classification Level Classification E-value
Superfamily Glycolipid transfer protein, GLTP 5.23e-55
Family Glycolipid transfer protein, GLTP 0.0000503
Further Details:      
 
Domain Number 2 Region: 12-107
Classification Level Classification E-value
Superfamily PH domain-like 2.62e-17
Family Pleckstrin-homology domain (PH domain) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011231   Gene: ENSMGAG00000010790   Transcript: ENSMGAT00000012101
Sequence length 526
Comment pep:known_by_projection chromosome:UMD2:6:34417796:34430348:1 gene:ENSMGAG00000010790 transcript:ENSMGAT00000012101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEWAFLKGGRYFCLLGWQPRWFLLCGGILSYYDSQEDAWKGCKGSIQMAVCEIQVHPADN
TRMDLIIPGEQYFYLKARNAVERQKWLVALGTAKACLTDSRTQKEKEFTENTEALKTKMS
ELRLYCNLLVQQVHKTKEASISAVSDPESGIDVGALLKSTCDTFLKTLEECMQIANTAFT
SELLHQTPPGSPHLAVLRTNKIKHSILSSHTSTERQMELNPCENGSVKAEINQQEQTFIK
SLACLNLEINEGSRDVSVEDHIEEDSAGKLQGMKKDGENKLQAVGSLDSQKFLQSETNSL
SGLTLCEEDENENGFPTFFSVMSNRFSDIELQEEEGIPTEEFLESCYAIVPVLDKLGPTV
FAPVKMDFVGNIKKINQKFITNKEEFDTLQKIVLHEVSAGVAQVRNSATEALLWLKRGLK
FLKGFLTEVKNGEKNIQTALNNAYGKTLRQHHGWVVRGVFALALRAAPTYEDFVAALSVE
DCDPQEETFYKAMQRDLNIYLPAMEKQLNILDTLYEVHGLESDEVV
Download sequence
Identical sequences G1NE95
ENSMGAP00000011231 ENSMGAP00000011231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]