SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011290 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011290
Domain Number 1 Region: 2-167
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.18e-46
Family DBL homology domain (DH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 157-296
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-18
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 3 Region: 310-369
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-17
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011290   Gene: ENSMGAG00000010835   Transcript: ENSMGAT00000012161
Sequence length 390
Comment pep:known_by_projection chromosome:UMD2:11:23430875:23466370:-1 gene:ENSMGAG00000010835 transcript:ENSMGAT00000012161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKTESHHLFSNITDVYEASKKFFKELEARHQNNIFIDDISDIVEKHSSSTFDPYVKYCT
NEVYQQRTLQKLLATNPAFKEVLSRIESHEDCRNLPMISFLILPMQRVTRLPLLMDTICQ
KTPKDSPKYENCKQALKEVSKLVRLCNEGARKMERTEMMYTINSQLEFKIKPFPLVSSSR
WLVKRGELTAYVEDTGLFSKRTSKQQVYFFLFNDVLIITKKKSEESYNVTDYSLRDQLVV
QQCDSEDLTSSPMKNTSELPSSPLRLSVLSNHAGEKVELLLGTETQSERARWITVLGQDR
DRQSTDRTTLTQVEIIRTYTAKQSDELSLQVADVVLVYQKVNDGWYEGERLRDGERGWFP
MECAKEITCRATIDKNMERMGRLLGLETNV
Download sequence
Identical sequences G1NEE2
ENSMGAP00000011290 ENSMGAP00000011290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]