SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011342 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011342
Domain Number 1 Region: 353-488,680-811
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.35e-40
Family Tandem AAA-ATPase domain 0.001
Further Details:      
 
Domain Number 2 Region: 118-203
Classification Level Classification E-value
Superfamily DEATH domain 0.0000129
Family Caspase recruitment domain, CARD 0.03
Further Details:      
 
Domain Number 3 Region: 518-595
Classification Level Classification E-value
Superfamily ARM repeat 0.0000558
Family BC3264-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011342   Gene: ENSMGAG00000010882   Transcript: ENSMGAT00000012216
Sequence length 1006
Comment pep:known_by_projection chromosome:UMD2:7:22075126:22104699:1 gene:ENSMGAG00000010882 transcript:ENSMGAT00000012216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEECRDERFLYMISCFRPRLKRCIRVHPVLDWLPSLSAEEKERVRVAALQRGEVEGAEE
LLRAVERGPRGPGWFTEFLLALKKGGCDLAACYVNPSQLPSPREEDDHDLCVHLVQLLHG
TLVDNMQTRHVAAKCLELGIFQEEDLVGIETVTDSRGNRDGARELLSRIVQKKDWFSQFL
VALRETQHESLADDLSGNTGGTENKENELKNSTSKETEGASQPGHAVTEDLKQQENLDDS
FVRESSVLETSVEKNSVVSGLVRESLVAVGDASNLNENLGRSSPTSDSGEDEAEGRASPE
PDLILRDYQMEVAKPALNGENIIICLPTGSGKTRVAVYITKDHLDKKKKASEPGKVIVLV
NKVPLVEQHLRKEFNPFLKRWYQVIGLSGDSELKISFPEVVKRNDVIICTAQILENSLLN
ATEEDEGVHLSADFSLMIIDECHHTQKEGVYNNIMRRYLKDKIKNRKQAKENKPLIPQPQ
ILGLTASPGVGGAKSRPKAEEHILKICANLDACRIMTVTEHASQLKNQVKDPFKKTVIAD
DKRRDPFRERIIEIMQDIQKYCQLYPKSEFGSQPYEQWVIREERRAAKEEKRKERVCAEH
LKKYNDALQINDTIRMVDAYNHLNNFYKELKRKKTAGSDDDEEPLVSKKDETDEFLMGLF
HEKKKQLKELARKPEYDNEKLMKLRNTLMEEFTKTEESRGIIFTKTRQSALALYHWIMDN
PKFEEVGIKAHYLIGAGHNSETKPMTQNEQREVIDKFRGGSINLLIATTVAEEGLDIKEC
NIVIRYGLVTNEIAMVQARGRARADESTYALVASSGSGAVEREDVNIFRENMMYKAIQRV
QEMPPEEYLNKIQDFQLQSIVEKRMKAKRDQRKTYKKNPSLITFLCKNCHKVICSGEDIR
VIENMHHVSVKKDFQHLYHIRENRTLQDKHADYQTNVEIICKDCGQPWGNMMVYRGLDLP
CLKIRNFVVVFEDKKTTKEIFKKWGELPITFPNLDYAAHCPSSDED
Download sequence
Identical sequences G1NEI2
ENSMGAP00000011342 ENSMGAP00000011342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]