SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011486 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011486
Domain Number 1 Region: 8-412
Classification Level Classification E-value
Superfamily Ras GEF 3.53e-99
Family Ras GEF 0.00036
Further Details:      
 
Domain Number 2 Region: 485-543
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.49e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00092
Further Details:      
 
Domain Number 3 Region: 417-496
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000032
Family Calmodulin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011486   Gene: ENSMGAG00000010985   Transcript: ENSMGAT00000012363
Sequence length 691
Comment pep:known_by_projection chromosome:UMD2:2:31517140:31556127:-1 gene:ENSMGAG00000010985 transcript:ENSMGAT00000012363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSNTLGKAATLDELLNACIEMFDDRGNQCSSHLPRIFLLMHRWYLPSTELAVKLLNTYR
DASGENCNEFRLKICYFMRYWILEFPAEFNLDLGLIRLTEEFRELASQLGYEDHIDLIDI
SSIPSYDWMRRVTQRKKISKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYV
IHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPLQRAEVITKFINVAQKLLHLQNFNT
LMAVVGGLSHSSISRLKETHSHLSSEVTKDWNEMTELVSSNGNYCNYRKAFADCVGFKIP
ILGVHLKDLIAVHVIFPDWIDENKVNIVKMQQLSITLNELVSLQTASHHLEPNMDLINLL
TLSLDLYHTEDDIYKLSLVLEPRNSKSPTSPTTPSKPVVPLEWASGVVPKPDPTVINKHI
RKLVDSVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKEEMMAYFLRA
KSQFQCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCRDLLV
LACRKFSRGTSVGSNHGSLPSSPSLPPAQDEVFEFPSVNAEHQDLDGRAITLVTGSSRKI
SVRLQRATASQATQTEPLWHEPGWNDSGSHTFPKMKSKFHGKAGKNKGFAKWENEKPSMQ
ADVDIDAEAPQHILEHNGIETLPERQESEDS
Download sequence
Identical sequences G1NEU8
ENSMGAP00000011486 ENSMGAP00000011486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]