SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011510 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011510
Domain Number 1 Region: 240-570
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.42e-53
Family Diacylglycerol kinase-like 0.0079
Further Details:      
 
Domain Number 2 Region: 758-879
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.29e-21
Family Ankyrin repeat 0.00086
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000011510
Domain Number - Region: 41-93
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00227
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011510   Gene: ENSMGAG00000011016   Transcript: ENSMGAT00000012387
Sequence length 893
Comment pep:known_by_projection chromosome:UMD2:5:24357334:24376887:-1 gene:ENSMGAG00000011016 transcript:ENSMGAT00000012387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKAIAKSSLQHMVAQPNPALALRSDSERQIRSTVDWSETAVYGEHIWFETNVSGDFCYVG
EQNCMAKLLQKPLSRRKCAACKIIVHTPCIEQLEKINFRCKPSFRESGSRNVREPIVVRH
HWVHRRRQEGKCRQCGKGFQQKFAFHSKEIVAISCSWCKQAYHSKVSCFMLQHIEEPCSL
GAHAAVVVPPTWILRVRRPQNPMKSSKKKKRTSFKRKSSKKGAEEGRWKPFVIKPMPAPL
MKPLLVFVNPRSGGNQGAKIIQSFMWYLNPRQVFDLSQGGPKEALELYRKVHNLRILACG
GDGTVGWILSILDQLRLNPPPPVAILPLGTGNDLARTLNWGGGYTDEPLSKILSHVEDGN
IVQLDRWNLHVEANPEANPEEKDETAADKLPLDVFNNYFSLGFDARVTLEFHESREANPE
KFNSRFRNKMFYAGTAFSDFLTGSSKDLAKHVKLVCDGVDLTPKIQDLKPQCLVFLNIPR
YCAGTMPWGNPGEHHDFEPQRHDDGCIEVIGFTMTSLAALQVGGHGERLCQCRQVVLTTS
KAIPMQVDGEPCKLAASCIHISLRNQANMVQKTKRRNSMPLLNDQQPVPERLRIRVSRIS
MRDYEALHYDKEKLKEASVPLGIIVVPGDSDLELCRTQIERLQEEGDGAKPKTLSSQKLS
PKWCFLDSTTADRFYRIDRAQEHLNYVTEISQDELYVLDPELVITQTVGTSPAMPDLVDS
SATPPGHHFAFPSSSSSPPCSPAPSTDAELCLLHKDDLIEAAKSGNFSKFQELHRAGRDL
MVRDSSGRTVLHHAVISGSKDIVKYIIENAPSEILDATEEENGETSLHQAAALRHRTICH
YIVEAGASLMKTDLQGDTPKHRAEKANDPDLAAYLENRQHYQMIQREDQETAV
Download sequence
Identical sequences G1NEW6
ENSMGAP00000011510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]