SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011637 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011637
Domain Number 1 Region: 800-884
Classification Level Classification E-value
Superfamily DEATH domain 7.06e-24
Family DEATH domain, DD 0.0000465
Further Details:      
 
Domain Number 2 Region: 127-219
Classification Level Classification E-value
Superfamily Immunoglobulin 8.3e-17
Family I set domains 0.022
Further Details:      
 
Domain Number 3 Region: 218-269
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000275
Family TSP-1 type 1 repeat 0.00058
Further Details:      
 
Domain Number 4 Region: 272-326
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.00076
Further Details:      
 
Domain Number 5 Region: 21-123
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000156
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011637   Gene: ENSMGAG00000011105   Transcript: ENSMGAT00000012516
Sequence length 890
Comment pep:known_by_projection chromosome:UMD2:4:40729935:40810248:-1 gene:ENSMGAG00000011105 transcript:ENSMGAT00000012516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDDFFHELPETFPSDPPEPLPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVH
QKDHVVDERVDETSGLIVREVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVR
IAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEEVIDPVEDRNFYITID
HNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWSMCNSRCGRGFQ
KRTRTCTNPAPLNGGAFCEGQNVQKIACTTLCPVDGKWTSWSKWSTCGTECTHWRRRECT
APAPKNGGKDCDGLVLQSKNCTDGLCMQAAPDSDDVALYVGIVIAVIVCLAISVVVALFV
YRKNHRDFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSD
KIPMTNSPILDPLPNLKIKVYNTSGAVTPQDELSDFSSKLSPQITQSLLENETLNLKNQS
LARQTDPSCTAFGTFNSLGGHLVIPNSGVSLLIPAGAVPQGRVYEMYVTVHRKESMRPPV
EDSQTLLTPVVSCGPPGALLTRPVVLTMHHCAEPNMDDWQIQLKHQAAQGPWGDVVVVGE
ENFTTPCYIQLDPEACHILTETLSTYALVGQSITKAAAKRLKLAIFGPLSCSSLEYSIRV
YCLDDTQDALKEVLQLERQMGGQLLEEPKTLHFKGSTHNLRLSIHDIAHSLWKSKLLAKY
QEISFYHIWSGCQRNLHCTFTLERFSLNTLELVCKLCVRQVEGEGQIFQLNCSVSEEPTG
IDYPIMDSAGSITTIVGPNAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLKLDRYLNY
FATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGNY
Download sequence
Identical sequences G1NF69
ENSMGAP00000011637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]