SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011664 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011664
Domain Number 1 Region: 47-764
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.01e-256
Family Motor proteins 0.000000000275
Further Details:      
 
Domain Number 2 Region: 1171-1267
Classification Level Classification E-value
Superfamily PH domain-like 6.56e-30
Family Pleckstrin-homology domain (PH domain) 0.0054
Further Details:      
 
Domain Number 3 Region: 1351-1478
Classification Level Classification E-value
Superfamily PH domain-like 5.09e-25
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 4 Region: 1756-1822,1866-1910
Classification Level Classification E-value
Superfamily Second domain of FERM 7.14e-18
Family Second domain of FERM 0.008
Further Details:      
 
Domain Number 5 Region: 1289-1343
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000367
Family Pleckstrin-homology domain (PH domain) 0.0071
Further Details:      
 
Domain Number 6 Region: 1130-1172
Classification Level Classification E-value
Superfamily PH domain-like 0.000000197
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 
Domain Number 7 Region: 1914-2000
Classification Level Classification E-value
Superfamily PH domain-like 0.0000231
Family Third domain of FERM 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011664   Gene: ENSMGAG00000011147   Transcript: ENSMGAT00000012544
Sequence length 2018
Comment pep:novel chromosome:UMD2:7:23058128:23116260:-1 gene:ENSMGAG00000011147 transcript:ENSMGAT00000012544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVFLQGARVWLREQDQLQPCTVGLCADGNVRFTSDYGTVFQYPKASLSVEKVLPMHQSSV
SGVEDMSMLGDLHEASILLNLHQRYQQGNIYTNIGSILASVNPYRPIPGLYSMDAXRHDS
QCVLISGESGAGKTESTKLLLKFLSAMSQTSLGAPASEKSTHVEEAILESSPILEAFGNA
KTVYNNNSSRFGKFIQLHFSQHGHIQGGRVTDYLLEKNRVVHQNPGERNYHIFYALLAGV
SGELKESLSLAEPETYRYLSQSGCVNDENLNDGEMFTKVMTAMKVVDFSSEEIRDIFKLL
SGTLHLGNVEFMTAGGAQVTTKAVLNIASDLLGLDAFQLSDVLTQRSMILRGEEISSPLT
VEQAADSRDSLSMALYSQCFSWLISKINTKIKGRENFKSVGILDIFGFENFQVNRFEQFN
INYANEKLQEYFNKHIFSLEQLEYNREGINWEAIDWMDNAECLDLIEKKLGLLALVNEES
RFPKGTDNTLLEKLHSQHMSNPYYVKPRVTDHQFGIRHYAGEVLYDVRGFLEKNRDTFRD
DILNMLKDSRLDFIYDLFERVCSRCNEETLKMGTQRRRPTVSSQFRDSLHSLMATLSTSN
PFFIRCIKPNTEKAPNLFNPDVVLNQLRYSGMLETVKVRRAGFPIRCLFQDFLSRYKMLV
KVPSFSDDNNKAICARFLQAYDSSKKEWQLGKTKVFLKEALEQKLEKDREEELRKAAVVI
RAHVLGYMARKKYRKVLASVVTIQKNYRAYFWKKSLLRLKASAIVLQKHWRGHLARSLYQ
HLRQQELRRQQEAEERRRREKEEQIRREEEERQWQEEEARRRKQEEEEVKERKSKDHLEM
DRKKQEIAELKKEEERRQMEEILRLEKEIEKLQQQKEDHMSIICENTRNEINRQREEEIQ
RLEKEASRVAQEFLELLDFGNLDESVQNLERSLSSEGTLNIDCSLVAPLAEEEVDEGFHA
DDEQGMKNSDNCLEGDVGARLLHLQREMGEAAPASAQPMERTSSPRERSVLSDPAESSYN
TVSDTLRSNSGEVGEPIYNSPQDVESDYDHDELDGCGDAGSASAEPLNGEESLRHSHGTS
LDSNRGSLDSAGTHRSLSTAADPKFLDSEEEVDVYIDTDEEFCNGRVTIFNGSGPPYFHS
YLYMKGGLMNPWRRRWCVLKNEAFMWFRTKQEALKSGWLYKKGGGMSTLSRRNWKRRWFV
LRESKLMYFENDSEEKLKGTIDIRRAKEIVDIHEKENALDIVTEDRVYHIVAESPEDASG
WFNVLSRVHSATAQQLREMQDEQANPKNAVGTLDVGLIDSVCASDNPDRPNSFVIITANR
VIHCNSDTPEEMHHWISLLQKPKGESKVDGQEFLVRGWLHKEVQSSNKVSSLKMKKRWFV
LTNTALDYYKSSERTAAKLGTLVLNSLCSVVQPDERVFKDTGYWNIIVHGRKHSYRLYTK
LLNEAMRWASAIQGVIDSKVPIETPTQQLIRDIRENSTNLEVVEQTYRRNPILRYTQHPL
HSPLLPLPYGDVSVNLQQEKGYSSLQDEAVKIFNSLQEIETVSDPIPIIQGILQTCHDLK
PLRDEVYCQLIKQTNHMPHPNSTGNLHHWQLMACMSCTFLPSRGILRYLKFHLRRVKDLF
PDSEIDRYAQFISDSLKRTKTREFVPSQEEIQALLTREEMTTTVYCHGGGSCKITINSHT
SAGEVVEKLIRGLAMEDSRNMFALFEHNQQVDRAVESRVIVADILAKFERLAGSEEEEEE
GQWQLYFKLYCFLDIENVPKDGVEFAFMFEQAHESLIDGHFPAPEDTLQRLAALRLQYLH
GDYSKISWSLDGIYPVNRLKSKILHSTKSSGTSSHTLERRRTSFLEGTLKRGFKTGSVKK
QKVEEEQMMEMWVKEELSAARASIAQKWTKLQGLSQHQAMVKYMSIVKEWPGYGSTLFDV
ECKEGGFPNDLWLGVSTENVSVYKRGDPKPLETFQYEHIVFFGAPQPNTFKITVDEREMF
FETAQVGEIIKIMKAYINMIVKKRCSVKSGTSVDSRAS
Download sequence
Identical sequences G1NF93
ENSMGAP00000011664 ENSMGAP00000011664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]