SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011755 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011755
Domain Number 1 Region: 307-571
Classification Level Classification E-value
Superfamily NHL repeat 4.45e-50
Family NHL repeat 0.000055
Further Details:      
 
Domain Number 2 Region: 202-296
Classification Level Classification E-value
Superfamily E set domains 4.74e-25
Family Filamin repeat (rod domain) 0.0013
Further Details:      
 
Domain Number 3 Region: 2-47
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000458
Family B-box zinc-binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011755   Gene: ENSMGAG00000011254   Transcript: ENSMGAT00000012636
Sequence length 571
Comment pep:known_by_projection chromosome:UMD2:6:41380451:41391399:-1 gene:ENSMGAG00000011254 transcript:ENSMGAT00000012636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLHFYCDTCSVPICRECTMGRHVGHSFIYLQDALQDSRTLTIQLLADAQQGRQAIQKALL
RYFSHIFSGLKNQKQTMLMDRTPFRMWWKRANLRCKVKIVLVSTRFGVKAKSLYLQVEKL
RQNLNKLDNTISAVQQVLEEGRTIDILLARDRMLAQVQELKNVRGLLQPQEDDRIMFTPP
DQALYMAIKSMGFVSSGAFAPLTKATGEGLKRALQGKVASFTVIGYDHDGEPRLSGGDMI
SAVVMGPDGNLFRADVSDQQNGTYLVSYRPQLEGEHLVSVMMCNQHIENSPFKVVVKSGR
SEGDSDGKLCRPWGVSVDKEGYIIVADRSNNRIQVFKPCGTFHHKFGTLGSPAGQFDRPA
GVACDVSRRIVVADKDNHRIQIFTFEGQFILKFGEKGTKNGQFNYPWDVAVNAEGKILVS
DTRNHRVQLFGPDGVFLNKYGFEGALWKHFDSPRGVTFNHEGHLVVTDFNNHRLLVIHAD
CQSARFLGSEGSGNGQFLRPQGVAVDQEGRIIVADSRNHRVQIFESNGSFLCKFGTQGSG
FGQMDRPSGIAVTPDGMIVVVDFGNNRILVF
Download sequence
Identical sequences G1NFG9
ENSMGAP00000011755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]