SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011784 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011784
Domain Number 1 Region: 269-354
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000145
Family PDZ domain 0.024
Further Details:      
 
Domain Number 2 Region: 736-788
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000109
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011784   Gene: ENSMGAG00000011273   Transcript: ENSMGAT00000012665
Sequence length 1056
Comment pep:known_by_projection chromosome:UMD2:8:31880049:31929714:-1 gene:ENSMGAG00000011273 transcript:ENSMGAT00000012665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVPPTPRMRTQHSCHFLNAIFLFLFRELRDTALVRNWVTKKIKVEFEELLQTKMTGKVLE
GLSLRDVYLGNVLPVFKAVRLIRPMVCSEEGCPEELGFEVDLEYNGGFHLAIDADLVFGK
SAYLFVKLSRVMGKLKLVFTRLPFTHWYFSFMDDPLIVFEVKSQFEGRPMPQLTSIIVNQ
FKKVIKRKHTLPNYKIRYKPFFPFQVSSPDEYEDRDLCIQDLPLTEGRLKVTLIECTRLF
IFGSYEKETNVHCTMELSSSIWEEKSRSSIKTAELVKGNLQSVGLTLRLVQSKEDDAGHV
VIETVTPNSPAAAADLQRGDRLLAIGSVKITSTVQVLKLIRQAGDKVLVFYERPVGYNQH
GSALQDGFGQLEDTAFLTQQEDDQVNVSADVDSRDFDSEFEDLACESPDQKEDTPTTPSP
KRSVVILAAKPLGTISPILNRKLHLGNYQTTSKMQQKDGAKLATPKASESSDASQLSGKQ
SQGSGAKPPVPPRPQIRPTLPTNETQNLLESGSVSSEKIERPPPSSGNGDKCTEKVVKNN
DQTEDPTLSKVAIPKQDALKDGISENARGHKDGGDDHRTWESPEIPYRVRQGRWPKTRTS
SCLFEVEGSHKYLNVALWCRDPFKAGGFICLGYASIKLEEIALDCIATSSMEYVRTFKLS
APTPKAAVTRTALRNLTTHKGFNEKFCYGDIALHFKYFKEGEADDSNFLLEKEKECHLEE
EVNVLQKEDPYLGQIVLTENKHNFQDTQFQNPTWCDYCKKKVWTKAASQCMLCAYVCHKK
CQEKCLAETPFCVGAEKRPDRTAGGCRAEGQETSQAASIRVDSESKSVNRTAGLTRHIIN
TSTRLLNLRQVPKARLSEQGTEIVEPSPKHTPNTSDNESSDTEISGPSSPSKRASGSGIK
LVRKEGGLDDSVFIAVKEIGRDLYRSLPTEERFQKLEFMLDKLQNEIDQELENNNSLVKE
EKEATEARKKALISAALVKSGERLQALTLLMIHYRAGIEDIESLESMSSDRQSKRVTKDS
EEASIAEEVDNEDIGLTEAPTFNIISDESVDPPQSV
Download sequence
Identical sequences G1NFJ2
ENSMGAP00000011784 ENSMGAP00000011784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]