SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011798 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011798
Domain Number 1 Region: 75-261
Classification Level Classification E-value
Superfamily p53-like transcription factors 8.32e-72
Family T-box 0.00000148
Further Details:      
 
Domain Number 2 Region: 2388-2468
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011798   Gene: ENSMGAG00000011293   Transcript: ENSMGAT00000012679
Sequence length 3035
Comment pep:known_by_projection chromosome:UMD2:5:25747475:25792725:1 gene:ENSMGAG00000011293 transcript:ENSMGAT00000012679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMEKQQIVLANRDGGTVSSTAPAFFVILKQQQGNGKADQGILVANRDACALASGVLMPVK
PKIKTCLPADCVSGGITVTLDNNSMWNEFYHRNTEMILTKQGRRMFPYCRYWITGLDASQ
KYILVMDISPVDNHRYKWNGRWWEPSGKAEPHVLGRVFIHPESPSTGQYWMHQPVSFYKL
KLTNNTLDQEGHIILHSMHRYLPRLHLVPADKATEVIQLNGPDVHTFTFPQTEFFAVTAY
QNIQITQLKIDYNPFAKGFRDDGLNSRPQRDMKQNNSFELEEGNVFSSASIHSCPAEVDV
LELHRRIDSSFIGQNSSAMNLEKESFNTEQDFVGFLDTGLPSGDMLKLKQEVTESPIASS
YESSSRVASPLDPNGQFNVVIKEEPIDDYDYETNICTQGVSVKQEDTDEETDEYSNTDDD
DPVLQKCLRRYSEADRNDGDFKPRKRVLSSPSGVAKAKMLKLESGKMPVVYLEPCAVTKS
TVKISELPQTMLSSCKKDKSALTTVLDSLPVCFENHKGSYSDTAAITEEIPMKKMSPGNK
LAQKYSSIKEAQWILSKSPNFNLRSSVGCQVSDKEISGRKKTGVLKNSASLKGSGSSQNS
LSSGTTKRGRPRKLKISKAGRPPKGIGKPVITSKNSPMGPASVLPDVKPDLEDVDGVLFV
SFASKEALDIHTVDRAGGEESQNLQAPLLTTNDPDCQARIQVLEKELMEELKTLRHKQVI
HPSLQEVGLKLNSVDPTMSIDLKYLGVQLPLSYSNYSLWSYPGTNPNSPDTGFPFVSRTG
KTNDFRKIKGWRGKLHGASRNEGGSSEGSLKNRSAFCSDKLDEYLENEGKLMETSMGFSS
STPTSPVVYQLPTKSTSYVRTLDSVLKKQSTVIPSTSYTFKPASLSSTSRKARTQNRQAS
SNSRGKSSYKPILPSPFSAKQKQNFSASVEKAAKSLSSSSLTNQADGFLMPNLDESILPK
QISLRHTPQQQQAARPPGLSKSQVKLMDLEDCALWDGKPRTYITEERADISLATLLTAQA
SLKNKPIHKIIRRRAPPCNNDFCRLGCICASLALEKRQPTHCRRPDCMFGCTCLKRKVLV
VKGGSKHKKILKKAVRGNLVFYGSQEEQQEDEDVEEEGVGEEDEMKQKDKKKRKKVEYTI
CDSEPEKPLRNCPLWVKVEGEIDPEPIYIPTPSVIEPVKSTVLPNPEVVLSSKHRSSSGV
KTGRVYTPKPNPVIREEDKDPVYLYFESMMTCARVRVYEPGKEEKKQQKDQKHSQSSFVK
RVSCNSFFLPTDKELSKKESSKKESCKKETSEINKGPEKCGEKSSWSSHSEGDSSSASCV
HPTTPCAPTKLIEIISDCSWNEDCNKILTILSQHINSNMPQCLKVGSLIIELASEHKAQD
ANNPPVYSSRVKISVPSYQDSDEKPESPDLETPDSGVPSCKKAENVKFFQAYTLDKLREK
LHGGKGLPFYAGISPAGKLVVYKRKANMSHSGLIQVASNASGTPSVQVPTTSAPKTTSSI
STTSNPSVTTLKALIPPLRQIAARPSPGGVFTKFVMNKAGALQQKIPSVSTCQPLSRPQK
LSINPTPIMVVTPVVPTSLSPAHYTISPGVTTATTTFPVTVESTSVAPSTVSAPSQTRAN
EPASSPPAITVTGASATPGTNTCTTSSSATPTATVNVTKAAVVAAPAPPLSLPTVVTAPT
ITCPVITTSPSTVVLTTAVATSVVTTPASSVSSVPIILSGVKSAPSIAPKREDAAPQAQA
LNKTPPKIPPGTEKRVGPRLLHPNGQIIQLVPLQHFRAPGAQPSAQPNVQQPVMFRNPGS
VVGIRLPTPAKPPESSVSPASSVSSTPVTNSTVQTAGPKSSSTFTPATQASSLSPSVTRY
VSQTGTVTLKISPPAAANVTNQTTTESKITGNSGVLPASNANVLPLQSGSFALLQLAGQK
TVPNSILHHFASLQMKKDSKKISQKDDSGAAQQTETEKDLHSEESEVAESEVAVSVTPVE
SSTALEAFEKDSKVLEGSGDDGPPLQNDVSTDVISSDHSYISEKLNDEENEAVMDKKEDS
VYSENVGAVSANSETVCESLEYSLVAPLNDTHPQGLKDQETVQLKNHGKEQIHAEWEDKP
VKEQEGEVQAHMKEGNKASSGQSRRQQEQDTQLESKKEQTGTELPQNKTEFQDGPVQPKE
EKKECKASAEAESLREKKTSKSEISFAKEQCNALGDKQVISTEANSWSKISSIAPVSENK
REGANKADRSDIGDFIIPEQKAQEPRHHKKSSAPTTDTTDYMEEEEDDDDDDEDEKTDDS
AYEMLDGVSDFSSEEEIDVEKVDACEYSEDDEQVDIETVEELSEKINIARLKATAANIRP
SKEKYHARNSSDEKLTESPTKTTSTAPIKYNPPIWSRRQKSEEEAFAHYRQTHTANERRR
RNEMRDLFEKLKRALGLHSLSKVSKCYILKQAFDEIQGLTDQADKLTGQKNLLARKQDTL
IRKVSILSGKTEEVVLKKLEYMYAKQKAVEAQKKKKNVQPAESVVTSPASTHQEASSALP
RDLSKVPMTNRRGKPLILARKGSHTTENTSSSLTLTAASLVMTPQGQVLTLKSPLVPGQV
AAVPSTLLQAELKPRAVGNTMTAQQESEDSFMMPKIVNVTSLAAEEGLSLNPNRNKNSNT
AAASTQASEKSLVAPLESRKSDSILLEEKNKLCPGDSDGEGRSSTGSVKGFFENKDGFPQ
LQNVSCAKEPPESFGKKLCIGELVGSQARKKDGDHGGERLKTKELPFRKLQIKDSRIEME
LRKVASAMEEAELDAGELLSSIEESDDTDETLTSLLNEIAFLNQQLNDDASGMSELPSAL
SSDFSHGDAEGRRGTASDLTTADGSSFQFGHLGGAFKDLSEVPEGGGSLSPLLLHLEDDD
LTEGDKNSGEPSSEADVLKIVIGAEMKDALPNLSITSGGNGKTVANLAEATGVTPPILQM
KTNPEASNADTLWRPMPKLAPLGLKVASLPVDSEGQSAKVMPLLAPVVAKLAPTGVKSSS
VTAQEGQDNKAMPALAPVGTKFSNSGTLPSNSVGK
Download sequence
Identical sequences G1NFK4
ENSMGAP00000011798 ENSMGAP00000011798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]