SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011821 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011821
Domain Number 1 Region: 18-236
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.89e-36
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 262-408
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-22
Family Pleckstrin-homology domain (PH domain) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011821   Gene: ENSMGAG00000011307   Transcript: ENSMGAT00000012702
Sequence length 411
Comment pep:known_by_projection chromosome:UMD2:1:45378208:45397257:1 gene:ENSMGAG00000011307 transcript:ENSMGAT00000012702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSWHEFIKAQQTEQKHMNGRLQVKKEEAVWELFTSECTYFLDHLLVLKMIFMKTLKYLQS
NEFLLDMDLWRLFANLEELNKVSKNFVKKFFETVKEHVSESKSPMNFISMLRKFFQGDLC
QTHQIYCLNYTTAIFYLEKLRQREDFGIYLKQWCEQKEQCRRLQLTELLVAPLHHLTRYP
LLLNNIWKRSTDETEKDSIWSLKEKVEKSIRDLEGKVKWLDNFQKFRQLHEVIIWPEVWD
HNKRFFVPEVCLKQSLRENGSENILSSASRLLLHDGRLTLAESTRLLDIYLFLFDDFVLI
TKIKHNKKKYGGSDTGLTLVCPSLAPELQSVVREGGFCQVLDQPIPLDRLLLKNVDPIHV
TVFSLRNAFLIQHENRYRQCIAVFLLQAQTESAKKTWMSQIERAISNYVKR
Download sequence
Identical sequences G1NFM2
ENSMGAP00000011821 ENSMGAP00000011821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]