SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011823 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011823
Domain Number 1 Region: 668-935
Classification Level Classification E-value
Superfamily RNI-like 4.04e-57
Family 28-residue LRR 0.0062
Further Details:      
 
Domain Number 2 Region: 14-103
Classification Level Classification E-value
Superfamily DEATH domain 3.25e-18
Family Caspase recruitment domain, CARD 0.0089
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000011823
Domain Number - Region: 188-358
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00596
Family G proteins 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011823   Gene: ENSMGAG00000011313   Transcript: ENSMGAT00000012704
Sequence length 943
Comment pep:known_by_projection chromosome:UMD2:6:42083376:42102166:1 gene:ENSMGAG00000011313 transcript:ENSMGAT00000012704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKTSVEKPLAASPPSCIALLKVYRELLVSKIRHTQCLIDNLINNEYFSTEDAEIVVQFPT
QADKVRKILDLVQSKGEEVSEFFIHVLQNVTDAYYELQPWLDEIGYQPSENICSKPVINT
DPVSRYCQKLRYELGRDSKFVTSYAQREEMLLEEIYSNSIMEMVNFTNESLGEVCQLQAL
FDDAVGVINEDGETIYVFGDAGIGKSILLQKIQSLWAKKQLDIGAKFFFHFRCRMFSCFK
EDEAVCLKDLLFRYNCYPDQDPTEVFHHILQFPHTVLFTFDGFDEIYSNFDLSSVPEMCS
PNEPIHPLVLLVSLLRGKLLKGSKKILTARTGTEIQRNIIRKKVLLRGFSSNNLKEYTAM
FFKDVGQRTLILNQLEANPNLHSLCSVPLFCWIIFKCYEHFHSMFDSHELPDCSVTLTDV
FLLMIEVHLSRSLKTSLLKNNVRSQAEVFKSRKETLLALGKIAYKGMRNSIFIFEQEEVS
SANISEEDLQLGFLRTVKGYSGCDDQSTYEFLHLTLQSFFTALFLVMEERAGNKELLQFF
NECSSAEAAQRTCFHVPWLKKPLTGEDPFRNNEHFHFTNLFLCGLLSRSNEKLFKHLVLP
AVIRKKRKTLITYLGESMKSHLKGVTRSRLPKYNQVQVQPNFVWMLRCIYETQNEKVGKL
AAKRMHANYIKLTYCNAYSADCSAISFVMHHFQKRLALDLDNNNINDYGVKQLLPCFSKL
AVIRLSVNQITDHGARILYEELSKYQIVSYLGLYNNQITDIGAKYVAKLIEECSSLEYVK
IGANKITSEGGKCLAQAIQKSTTMFEIGMWGNQVGDEGAKAFAEALRNHPRLTNVSLAFN
GITTEGGKSIAEALQHNNSVKIFWLTKNELDDEAAMSFAEMLKINKKLVHLWLIQNQITA
KGVKYLSEALKENTAIKEVCLNGNLISQEEAKAFESEERIVCF
Download sequence
Identical sequences G1NFM4
ENSMGAP00000011823 ENSMGAP00000011823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]