SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011824 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011824
Domain Number 1 Region: 585-860
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.07e-78
Family Protein kinases, catalytic subunit 0.0000231
Further Details:      
 
Domain Number 2 Region: 425-539
Classification Level Classification E-value
Superfamily PH domain-like 1.54e-34
Family Pleckstrin-homology domain (PH domain) 0.0000274
Further Details:      
 
Domain Number 3 Region: 126-201
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.44e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0007
Further Details:      
 
Domain Number 4 Region: 265-329
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.52e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011824   Gene: ENSMGAG00000011300   Transcript: ENSMGAT00000012705
Sequence length 921
Comment pep:known_by_projection chromosome:UMD2:2:34138957:34178607:-1 gene:ENSMGAG00000011300 transcript:ENSMGAT00000012705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSPPSLQKFSPPTCHAAAPQTPSLSSSPLSGLSSRLSNGSFSTQSLTNSRGSMHGVSFLL
QIGLTRETVTIEAQDLSLSAVKDLVCSIVYQKFPECGFFGMYDKILLFRHDLNSDNILQR
ITSAEEIHEGDLVEVVLSALATVEDFQIRPHALYVHSYKAPTFCDYCGEMLWGLVRQGLK
CEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPGAGLSVPRPAQAEYTSSASEENNCLA
KSEQIVSFYLGREPSKRIPSWSGRPIWMEKMVLCRVKVPHTFAVHSYTRPTICQYCKRLL
KGFRQGMQCKDCRFNCHKRCASKVPKDCLGEVVFNGEPASPGQDLDLPMEVDSSEMNSDG
SRGLDDTEESSTPEDKIFFMDPSDLDTDKDEEAVKTISPSTSNNIPLMRVVQSIKHTKRK
SSTMVKEGWMVHYTSRDNLRKRHYWRLDSKCLTLFQNESGTKYYKEIPLSEILQVTQPRD
FSNMVQGSNPYCFEIITDTMVYFVGENNGSSHHSPVLAATGVGLDVAQGWEKAIRQALMP
VTPQASVCTAAGQGKDHKDLSLSISVSNCQVQENVDISSVYQIFADEVLGSGQFGIVYGG
KHRKTGRDVAIKVIDKMRFPTKQESQLRNEVAILQNLHHPGIVNLECMFETPERVFVVME
KLHGDMLEMILSSEKSRLPERITKFMVTQILVALRNLHFKNIVHCDLKPENVLLASAEPF
PQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIVYVSLSGT
FPFNEDEDINDQIQNAAFMYPPNPWKEISSEAIDLINNLLQVKMRKRFSVDKSLSHPWLQ
DYQTWLDLREFETRIGERYITHESDDARWKEHAYEHNLEYPQHFIIAPNPDDIHSAKLQQ
RPTPQTEAEXGKETGEQMSPV
Download sequence
Identical sequences G1NFM5
ENSMGAP00000011824 ENSMGAP00000011824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]