SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011829 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011829
Domain Number 1 Region: 46-257
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.04e-81
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000000362
Further Details:      
 
Domain Number 2 Region: 540-757
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.7e-61
Family Ankyrin repeat 0.0000245
Further Details:      
 
Domain Number 3 Region: 253-383
Classification Level Classification E-value
Superfamily E set domains 5.37e-47
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000121
Further Details:      
 
Domain Number 4 Region: 806-888
Classification Level Classification E-value
Superfamily DEATH domain 1.21e-17
Family DEATH domain, DD 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011829   Gene: ENSMGAG00000011299   Transcript: ENSMGAT00000012711
Sequence length 982
Comment pep:known_by_projection chromosome:UMD2:4:43102647:43149745:1 gene:ENSMGAG00000011299 transcript:ENSMGAT00000012711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGEDPYIMGVSDPQMFAMDQLMGMNTIFNNTGYITSDLPLRTADGPYLQIIEQPKQRGF
RFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKYVHLHAHSLVG
KFCEDGVCTVNAGPKDMVVGFANLGILHVTKKKVFETLETRMIDACKKGYNPGLLVHPEL
GYLQAEGCGDRQLTEREREIIRQAAVQQTKEMDLSVVRLMFTAFLPDSNGGFTRRLDPVI
SDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEDENGGMWE
GFGDFSPTDVHRQFAIVFKTPKYRDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKD
KEEVQRKRQKLMPNFSDGYGGGSGAGGGGMFGGGGGGAGSGFSYPSYGYSAFGGMHFHPG
TTKSNAGMKHELSNSTVEKDEESSDKQSGQWDMKHNVKVETVEKNECRTSGHYEEKEDAA
LCCKDEGNKAKCGCQDGLFLEKAMQLAKRHCNALFDYAVTGDVRMLLAVQRHLTAVQDDN
GDNVLHLSIIHLHRKLVKNLLEVMPDMNYNNIINMRNDLYQTPLHLAVITKQAEVVEDLL
KAGANVNLLDRHGNSVLHLAAAEGDDKILSLLLKHQKASSMIDLFNGEGLSAVHMVVIAN
SLSCLKLLIAAGVNVNAQEQKSGRTALHLAVEQENIPLAGCLLLEGDADVDSTTYDGTTP
LHIAAGRGFTKLAAVLKAAGADPHVENFEPLFDVEEDVKGDDDEGIVPGTTPLDMAANWE
VYDILNGKPYIAAAAVSEDLLTQGPLRELNENSKKQLYKLLETPDPSKNWSTLAEKLGLG
ILNNAFRLSPSPSKTLLDNYKISGGTVQELIAALRQMDHTEAIEVIQKALWSSQSQSHQE
DNTIETFPSSSPANFAKGETGELYNHKFQDTESTCDSGVETSFRKLSFTYSDSLNSKSSV
TLSKMTLGYSQESSVQSNYIPN
Download sequence
Identical sequences G1NFM9
ENSMGAP00000011829 XP_019470357.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]