SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011835 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011835
Domain Number 1 Region: 3-320
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.19e-60
Family Glutaminyl-peptide cyclotransferase-like 0.000000000912
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011835   Gene: ENSMGAG00000011319   Transcript: ENSMGAT00000012717
Sequence length 321
Comment pep:known_by_projection chromosome:UMD2:2:34190321:34199204:1 gene:ENSMGAG00000011319 transcript:ENSMGAT00000012717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHQPSILHPDAIQNVAEKTDVSEMWENDLRPILIERYPGSPGNHAVRQHIKQRLQRLQAG
WEIEEDTFQKYTPYGYQTFSNIISTLNPSAKRHLVLACHYDSKFFGPQWHGRVFVGATDS
AVPCAMMLELARALDNKLQSIQTSSTSRPDLSLQLIFFDGEEAFVRWSPSDSLYGSQHLA
QKMVSTPHPPGSTTTNQLQGMDLLVLLDLIGAPNPVFPNYFPNTSRWFQRLQAIEQKLHG
MNLLKNHLDETQYFQNNVHRGLVEDDHVPFLLRGVPVLHLIPSPFPEVWHTMEDTEENLD
QTTIENLSKILQVFVLEYLNL
Download sequence
Identical sequences G1NFN4
ENSMGAP00000011835 ENSMGAP00000011835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]