SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011859 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011859
Domain Number 1 Region: 76-376
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 9.26e-110
Family Pancreatic carboxypeptidases 0.0000031
Further Details:      
 
Domain Number 2 Region: 4-63
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0000000000000181
Family Pancreatic carboxypeptidase, activation domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011859   Gene: ENSMGAG00000011340   Transcript: ENSMGAT00000012741
Sequence length 380
Comment pep:known_by_projection chromosome:UMD2:3:65718314:65762442:-1 gene:ENSMGAG00000011340 transcript:ENSMGAT00000012741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVPALQVDLWQPSSTFHISEGTVIDVHVPQNTSRSLLPFLQQANIHYTILISDLQKAIEN
QTGQRASRHRRSLPAYNYEVYHSLEEIEEWMYYLNKTHSDLVHLFSVGKSYEGRPLFVLK
LGKRSRPYKKAVWIDCGIHAREWIGPAFCQWFVKEALQTYQTDPAMKKMLTQLYFYVMPV
FNVDGYHYSWTNDRFWRKTRSKNSRFWCYGVDANRNWKVKWCDEGASLHPCDDTYCGPFP
ESEPEVKAVAHFLRKHRKQIKAYLSFHAYAQMLLYPYSYKYATIPNFSCVESAAYNAVNA
LQSAYGVRYRYGPASSTLYVSSGSSMDWAYKNGIPYAFAFELRDTGHFGFLLPETLIRPT
CTETMLAVKNITFHLLKKCY
Download sequence
Identical sequences G1NFQ6
ENSMGAP00000011859 ENSMGAP00000011859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]