SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011862 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011862
Domain Number 1 Region: 34-213
Classification Level Classification E-value
Superfamily Sema domain 6.8e-21
Family Sema domain 0.014
Further Details:      
 
Domain Number 2 Region: 215-257
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000767
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 426-514
Classification Level Classification E-value
Superfamily E set domains 0.000014
Family E-set domains of sugar-utilizing enzymes 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011862   Gene: ENSMGAG00000011352   Transcript: ENSMGAT00000012744
Sequence length 795
Comment pep:novel chromosome:UMD2:1:45861020:45902074:1 gene:ENSMGAG00000011352 transcript:ENSMGAT00000012744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WGGRLFFPYYRLKAELDKDPELPSMVVMHQPHRSEHSFDLQGQVYLDCGCRSLLISSSLI
RQEERGWWVGVFHHNHGDRAWDSTAVCVFRMEELQDPTSRLFRDWFYVVAECICSPSDRC
CQVQSIKKSPTLIHSGLVAVYGTVVLNQIVLFLGTDDGQLLKAILNEDMKSNCPEILYEI
EEETSIFPKLRLDPVDSNYIYLFSANKVRRIPVANCGRYVSEQECLSAKDPYCGWCSLNQ
RCTLKENCTRSNSTKGWFNISHAPDKDLKILLRFPARNQISVSASISKTLTSCIIKIVKP
IEMPHENVVLKNSSCVCSLATSVILDHDCLVLEASLSSNSWNITETFQLEKISITEHCSR
CIHDGECASCNWTRVSPATACQVKISSQPRNQSSQCQGLNLLKNTSTGRLSRNQDNQKTL
KTEHINIHSIEPLWISTLGKSEITVKGENFTHASGIKLILTGSSGCKQEIIKVRNVINDT
QMTFALPPMRKEAKSVCIQADGRKCSPPVTLHYVSLPACFGITPNTSWISGGRKITTTGR
NLNVVDKVIISDDQRSNLTISEYPQNKSEYHYLSPSLSHATEGKVVDMIFKVETTFVPCV
KLHYHPDPVFINYQLHTELDPDLELKIYKENDNLNISKTEVEVYLSYMNGSQTAKIYFSV
QNITEKPDRSTILCKFKSFCFRSTLVRHNKRRKVKLGNFELEVKPTSSYIYLYVLILLPI
VVGVIIVAFIVTRYKSKELTRKQSQQLELLEYEIRKEIREGFAELQMDELDVVDSFGTVP
FLDYKHFAIRTFFPE
Download sequence
Identical sequences G1NFQ9
ENSMGAP00000011862 ENSMGAP00000011862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]