SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012171 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012171
Domain Number 1 Region: 225-352
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.89e-39
Family PLC-like (P variant) 0.0023
Further Details:      
 
Domain Number 2 Region: 59-223
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.12e-31
Family Dual specificity phosphatase-like 0.00015
Further Details:      
 
Domain Number 3 Region: 1453-1585
Classification Level Classification E-value
Superfamily SH2 domain 1.18e-23
Family SH2 domain 0.0017
Further Details:      
 
Domain Number 4 Region: 1583-1651
Classification Level Classification E-value
Superfamily PH domain-like 4.74e-18
Family Phosphotyrosine-binding domain (PTB) 0.0000802
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012171   Gene: ENSMGAG00000011587   Transcript: ENSMGAT00000013058
Sequence length 1651
Comment pep:known_by_projection chromosome:UMD2:7:23839453:23869233:1 gene:ENSMGAG00000011587 transcript:ENSMGAT00000013058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAATPCSPAVNYELPSPGQSITKQVDTLDATRSPRGGQAHRKTARSMSVTAAMESSCELD
LVYITERIIAVSYPSTAEEQSFRSNLREVAHMLKSKHGDNYVLFNLSERRHDISKLHPKV
LDFGWPDLHTPALEKICSICKAMDTWLNAAAHNVVVLHNKGNRGRLGVVVAAYMHYSNIS
ASADQALDRFAMKRFYEDKVVPVEQPSQKRYIHYFSGLLSGSIKMNNKPLFLHHVIMHGI
PNFESKGGCRPFLKIYQAMQPVYTSGIYNVQGDSQTGICITIEPGLLLKGDILLKCYHKK
FRSPTRDVIFRVQFHTCAVHDLDIVFGKEDLDEAFRDERFPEYGKVEFVFSYGPEKIQGM
EHLENGPSVSVDYNTSDPLIRWDSYENFNIQREDSAEGAWAEPTLPGKHLEKEVGHTQGP
LDGSLYAKVKKKDSLHGSIGAVNTARLPLSAAPNHVEHTLSVSSDSGNSTASTKTDRTDE
PGAPGAPGGHTVLSPEEKRELDRLLVGFGLESAAPMHNHAPGPAPARLPAGSGRHVVPAQ
VHVNGAGTPLLAERETDILDDELPNQDGHSVGSLGTLSSLDGTTTASEAGFHEAPRVGSL
SSLPNGPASYNGAEKMLKEGLYEAEPLSNGAYPYSNQNTLMGHHLRDPLAHLRPSASAQE
HLAGYSQRQPASASPAWLQPPVPQPYLYGYDLPSAHRSQSFPAVGTAKYDANPALPQAPA
RSTSSREAVQRGLNSWQQQGGSRPPSQLHDGGLESHSPSLSSCSPQPSPLQPMPPHSHSM
PEFPRAPSRREIEQSIEALDVLMLDLAPSVHKSQSVPSAVARQDKPAATLSSLSAQPLSG
HYAQPAPQVVQPRSFGTSVGTDPLAKAYSPGPLVPAARSTVEPDYTVHEYRETYTPYSYQ
PEPRSYGSAPASILPLSASYSPAGSQQLLVSSPPSPTAPAQSQLPHKGLESYEDLSRSGE
EPLNLEGLVAHRVAGVQSREKSPEESTTSARRRTPSDSHYEKSSPEPSSPSPTVLSPEVV
STIAANPGGRPKEVRLGTGAGGAGGERLLFPPTLVPTVRSPPGLAKTPLSALGLKPHNPA
DILLHPVGELEGEAGADSEEEPRSYVESVARTATTGRAGNLPAAQPVGLEVPARNGAFGN
SFTVPSPISTSSPIHSIDGASLRSYPSEGSPHGTVTPPHAVAEPAYRSPIVSQTPSAHSS
YQTSSPSSFQAGTLGSPYASPDYPDGRAGFQPDPQVRQQPQVSVVGVHALPGSPRTLHRT
VATNTPPSPGFGRRAANPAVASTPGSPGLGRHAMSPHAPPGSPSLARHQMAAVPPGSPVY
GYSSPEERRPTLSRQSSASGYQPPSTPSFPVSPAYYPGTSTPHSSSPDSAAYRQGSPTPQ
PALPEKRRVSAGERSNSLPNYATVNGKASSPLSSGMSSPSSGSTVAFSHTLPDFSKFSMP
DISPETRANVKFVQDTSKYWYKPDISREQAIALLKDREPGAFIIRDSHSFRGAYGLAMKV
ASPPPTVMQQNKKGDITNELVRHFLIETSPRGVKLKGCPNEPNFGCLSALVYQHSIMPLA
LPCKLVIPDRDPMEEKKDVASTTNSATDLLKQGAACNVLFINSVEMESLTGPQAISKAVA
ETLVADPTPNATIVHFKVSAQGITLTDNQRK
Download sequence
Identical sequences G1NGF9
ENSMGAP00000012171 ENSMGAP00000012171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]