SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012214 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012214
Domain Number 1 Region: 499-736
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.15e-70
Family Protein kinases, catalytic subunit 0.0000451
Further Details:      
 
Domain Number 2 Region: 336-454
Classification Level Classification E-value
Superfamily PH domain-like 1.27e-24
Family Pleckstrin-homology domain (PH domain) 0.0000267
Further Details:      
 
Domain Number 3 Region: 37-110
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.42e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00071
Further Details:      
 
Domain Number 4 Region: 176-234
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.39e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012214   Gene: ENSMGAG00000011631   Transcript: ENSMGAT00000013101
Sequence length 738
Comment pep:known_by_projection chromosome:UMD2:8:34708057:34753506:-1 gene:ENSMGAG00000011631 transcript:ENSMGAT00000013101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFPECGFYGMYDKILLFRHDPTSENILQLVKSAGDIQEGDLVEVVLSASATFEDFQIRPH
ALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNV
SLTGLSTIRTVSAETSPSVSDEALLQKTPSESFTGREKRSNSQSYIGRPIQLDKILLSKV
KVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQCKDCRFNCHKRCAPKVPNNCLGEVAIN
GDLLSPGAESDVVMEEGSDDNDSERNSSFIDDMEESIAHDSEISMTGCHSDSGEMQDPDP
DHDESNRMISPSTSNNIPLMRVVQSVKHTKRRSSTVMKEGWMVHYTSKDTLXXXXYWRLD
SKCITLFQNDTGSKYYKKFLLSEIFSLEPAKTFTLLPQGANPHCFEISTANIVYYVGENI
ENLSSVPLNNGVLTSGIGIDVARMWEIAIQHALMPVIPKGASMGSGPSLHRDISISISVS
NCQVQENVDISTVYQIFPDEVLGSGQFGIVYGGKHRKTGRDVAIKIIDKLRFPTKQESQL
RNEVAILQNLHHPGVVNLECMFETPERVFVVMEKLHGDMLEMILSSEKGRLPERITKFLI
TQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTP
AYLAPEVLRNKGYNRSLDMWSVGVIIYVSLSGTFPFNEDEDIHDQIQNAAFMYPPNPWKE
ISHEGNIVCGCLYINAKK
Download sequence
Identical sequences G1NGJ2
ENSMGAP00000012214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]