SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012225 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012225
Domain Number 1 Region: 203-537
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.88e-70
Family Pancreatic carboxypeptidases 0.0000025
Further Details:      
 
Domain Number 2 Region: 27-188
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.8e-47
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0001
Further Details:      
 
Domain Number 3 Region: 537-621
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.65e-19
Family Carboxypeptidase regulatory domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012225   Gene: ENSMGAG00000011662   Transcript: ENSMGAT00000013113
Sequence length 650
Comment pep:known_by_projection chromosome:UMD2:8:34799323:34840251:-1 gene:ENSMGAG00000011662 transcript:ENSMGAT00000013113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRTARDSNSGVISDHSVFSANNEVGSYCPPLGLETLKITDFQLHASTAKRYGLGAHRGRL
NIQAGVNENDFYDGAWCAGRNDPFQWIEVDARRLTKFTGVITQGRNSLWSSNWVTSFRVL
VSNDSHAWTAVRNESGDVIFEGNSEKEIPVLNMLPVPLVARYIRINPRSWYEEGSICMRL
EILGCPLPDPNNYYHRRNEMTTTDNLDFKHHNYKEMRQLMKTVNKMCPNITRIYNIGKSH
QGLKLYAVEISDNPGEHEVGEPEFRYIAGAHGNEVLGRELILLLMQFMCQEYLAGNPRIV
HLIEDTRIHLLPSVNPDGYDKAYKASKGSELGGWSLGRWTQDGIDINNNFPDLNSLLWES
EDQKKSKRKVPNHHIPIPDWYLSENATVAVETRAIIAWMEKIPFVLGGNLQGGELVVAYP
YDMVRSLWKTQDYTPTPDDHVFRWLAYSYASTHRLMTDARRRACHTEDFQKEDGTVNGAS
WHTVAGSINDFSYLHTNCFELSIYVGCDKYPHESELPEEWENNRESLIVFMEQVHRGIKG
IVKDIHGRGIPNAIISVEGVNHDIRTGADGDYWRLLNPGEYMVSVKAEGYTTATKNCEVG
YDMGATRCDFTISKTNLARIKEIMRKFGKQPISLSLRRLRQRARQWRQRR
Download sequence
Identical sequences G1NGK2
ENSMGAP00000012225 ENSMGAP00000012225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]