SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012230 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012230
Domain Number 1 Region: 144-456
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.11e-117
Family Transglutaminase core 0.0000000198
Further Details:      
 
Domain Number 2 Region: 6-142
Classification Level Classification E-value
Superfamily E set domains 9.45e-41
Family Transglutaminase N-terminal domain 0.00068
Further Details:      
 
Domain Number 3 Region: 610-708
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.9e-24
Family Transglutaminase, two C-terminal domains 0.002
Further Details:      
 
Domain Number 4 Region: 495-605
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.62e-18
Family Transglutaminase, two C-terminal domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012230   Gene: ENSMGAG00000011669   Transcript: ENSMGAT00000013118
Sequence length 709
Comment pep:known_by_projection chromosome:UMD2:6:44059217:44069665:-1 gene:ENSMGAG00000011669 transcript:ENSMGAT00000013118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQDRDLKVTKVDFLKSQNSVQHHTDAYNTSNLVVRRGQPFLVQLTLSRELRASDKLSLH
FSIGEKPKEPTGTLMSLNPRSTRNVSGWQISIVKSSGTECTLSVTSAPNAAVGIYGLIVK
TGPNVYKPEKNTVYLLFNPWCEGDIVFLSNEAERKEYVLNDTGYIYVGSAFNIHSKPWNF
GQFEESILDACMYLLDKSKLKMSSRRDPVVVSRAMSALVNANDDSGVVLGNWSGKYENGT
SPMAWIGSVAILQQYYKTKKPVSYGQCWVFSGVLTTVMRCLGIPARSVSNFNSAHDTDEN
LRVDVYLNEKGEKLKWMSSDSVWNFHVWNDVWMKRKDLPSGFDGWQAIDATPQEQSQGIF
QCGPCPVKAVKDGDVYLPYDSKFVYAEVNADKVYWRVKEENGRNKYTKLGVESQSIGANI
STKAVGQNRREDITWQYKFPEGSSEERASMKRAVSYLQPSGMTPRSRFAAVPLDVNLRNA
GDEDTIQNEVVPKSGVQLEITNEKPLCPGNPIEVVITVKSTVAGSWTVDLASSCQLQSYT
GKVHANLGYIKQTVKVEGQSEVRVPLKIMPEAYMKALATVDDEEHVHVTAIAEIQGTPEK
LTKEVSLSFEYPPIQVQMPETAQVNKDFTCAFIFKNKLNVPLDNCKLMVEGLGIFKMATF
DEGDIQPGRIIKSEVICTPTRVGEKKIVARLTSNQVKDISVEKGIMVTH
Download sequence
Identical sequences G1NGK7
XP_003207295.1.16129 ENSMGAP00000012230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]