SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012377 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012377
Domain Number 1 Region: 247-526
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.63e-52
Family Pancreatic carboxypeptidases 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012377   Gene: ENSMGAG00000011798   Transcript: ENSMGAT00000013267
Sequence length 583
Comment pep:known_by_projection chromosome:UMD2:1:48725384:48735293:-1 gene:ENSMGAG00000011798 transcript:ENSMGAT00000013267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSVCADILPRAKQLPFDSEVVVPHLQELQNPCDLPPPGQFSQVHWPNQCEVSRDRIEHID
WIPSSPEPLYIPTGLEITPSYQPPHKGTVIYLGEVANSELYFMYSQMRGLCPVKQIFHQK
VDNTLIFEARFESGNLQKVVKINEFEYQLTLRTDLYTSRHVQWFYFQVSNTQAGMPYRFT
IVNFTKRKSLYRHGLRPLLYSEVDAKEHNIGWRRAGNEIKYYKTNVSEGGRQYFSLTWTF
QFPHDRDTCYFAHCYPYTYSNLQKYLVAVSKDPVKSKFCKIHILCHSLAGNIVHVLTITN
PPESGKDTKRKAVILTARVHPGETNSSWIMKGILDYILGNSSKAHQLRDTFVFKVVPMLN
PDGVIVGNHRCSLTGHDLNRKYKSKVKKCYPSIWYTRNMIRRVMEKRDIFLYCDIHGHNR
KQNAFMYGCEREQEPKAPHLRPRAFPLLLSKNCPDKFSFPDCHFRVRKSKESTGRVVMWK
MGINNSYTLEASVCGSKLGWRQSTHFDIKDFESIGQHFCDALLNYSVDNKEHYLCLKEHE
QVVTQQAKVSSEVLNSDALDWDSSSRSSDSSDSCDVAAHRLKL
Download sequence
Identical sequences G1NGX3
ENSMGAP00000012377 ENSMGAP00000012377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]