SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012386 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012386
Domain Number 1 Region: 6-199
Classification Level Classification E-value
Superfamily E set domains 1.32e-79
Family RhoGDI-like 0.0000000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012386   Gene: ENSMGAG00000011805   Transcript: ENSMGAT00000013276
Sequence length 200
Comment pep:known_by_projection chromosome:UMD2:1:48775111:48783322:1 gene:ENSMGAG00000011805 transcript:ENSMGAT00000013276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEKTQEPHVEEDDDELDGKLNYKPPPQKTLQELQELDKDDESLTKYKKSLLGDGPVVAD
PTAPNVVVTRLTLVCDSAPGPITMDLTGDLEALKKETFVLKEGVEYRVKIHFKVNRDIVS
GLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPIEEAPKGMLARGTYHNKSFFTDD
DKHDHLTWEWNLSIKKEWTE
Download sequence
Identical sequences F1NLT8 G1NGY1
NP_001264293.1.86415 XP_003202229.1.16129 XP_010708001.1.16129 XP_021271138.1.32913 ENSMGAP00000012386 ENSMGAP00000012386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]