SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012426 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012426
Domain Number 1 Region: 20-301
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-61
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 479-562
Classification Level Classification E-value
Superfamily DEATH domain 7.06e-16
Family Caspase recruitment domain, CARD 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012426   Gene: ENSMGAG00000011842   Transcript: ENSMGAT00000013317
Sequence length 574
Comment pep:known_by_projection chromosome:UMD2:3:74788167:74810496:1 gene:ENSMGAG00000011842 transcript:ENSMGAT00000013317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTSVLYWEERGQKKATGSAIPTHKLPDLRFISRGAYGTVSAARHADWRVPVALKCLQGPL
LDSDRNHLLKEAEILHKARFSYILPILGICNEPDFLGIVTEYMANGSLNQLLHGKDVYPD
IAWCLRYRILYEIALGVNYLHNMNPPLLHHDLKTQNILLDDEFHVKIADFGMSKWRVISM
SQSRSETSLPEGGTIVYMPPEDYNPSQKTRASVKHDIYSFAIIIWEVMSRKHPFEEVINP
LQIMYSVSQGQRLDLSETSLSMDIPHRALVIRLIESGWAQNPDERPSFLKCLIDLEPVLR
TFDEIAILEAVILLKRSKSQYESQCIHRSGKKAVVEKTSLNIPLNPQEETSASIHCDALP
LRSISPDTSRLKTPPQCNILSSVNAGEKAEKTIDFIAINQSIKKSADGNSCGLHSLSCQS
VDENLSVTQSAKPFVHPYSYLPSSEKNISVASNSSSCVLQTSPISSDFVLETIQQNVAHQ
WIQSKREEIIDQMTEACLNQSLDALLSRFLLMKEDYELISTKPTRTSKVRQLLDTSDNQG
EEFARIIIQKLKDNKQLGLQPYPDIVFNSLRLHL
Download sequence
Identical sequences G1NH07
ENSMGAP00000012426 ENSMGAP00000012426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]