SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012503 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012503
Domain Number 1 Region: 611-677,718-815
Classification Level Classification E-value
Superfamily PH domain-like 2.57e-31
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 2 Region: 824-939
Classification Level Classification E-value
Superfamily PH domain-like 2.05e-18
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 3 Region: 1235-1368
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-17
Family Second domain of FERM 0.0062
Further Details:      
 
Domain Number 4 Region: 1136-1241
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000031
Family Ubiquitin-related 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012503   Gene: ENSMGAG00000011911   Transcript: ENSMGAT00000013399
Sequence length 1512
Comment pep:known_by_projection chromosome:UMD2:5:29846870:29890675:1 gene:ENSMGAG00000011911 transcript:ENSMGAT00000013399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELTEENGSCMDWQKRCLALESQLFKFRLQASKIRELLAEKALKMQELEQRVIEAEQRA
EDAEKQVRVMGEEIKLANMKTSESNSTLYRKYQELMGTVQRKEDVISRLEIQLAKQKQLR
TEEAKIIQEKAAKIKEWVTFKLKELELENYHLKNCNQRLTEQIEALQDTLQAWLLLEVCC
PCSNGTEERLNLQRGWLWCSFLSLVLENKEHCVDRCISLCLSVRVSPLACPDMAATEIQL
QQITLARNIFYDMTSIPPLESLWSCNSLKPRASQVSYPEKIDQKSRLLAPAFRQACQTGL
TKHVLSTTNIVLASDNFTEDGEDKSLLSQNTLKLLADPSSWNLSTEKDTFSAISSEHRLG
CSDPRSLDPPTEPTKLLGALTFQSSLESNHSTPDDLSARFHSHCLDSSFSGRLQTAEPPL
VVSASAVTACSTCPERERGLSTSMTFPKIRTPSIPRDSIQLAKRHYSQPQSGTSSSCRVM
SFEASTFQPIKDSPVYHRPVEETDIDDDAVLEKMETEAGLVREEAGMCEINHLPTEQREV
VSSKAGVLEPGGKPPTPPLHRFPSWFCCHVLNISXSGMRMSEVATVNDTPSCFSNFSYSA
SGPFTCLIYRNITVPVYTTLKGKATQISNVPFLDESSGSDDDCGSRASFRNSAAESENRK
ASVPGSPRATKRGVSMSSVSSESDYAVPPDAYSLDGDYSEPEHKLQRTSSYSTDGGICTE
PIEKSGYLLKMGSQVKMWKRRWFVLRNRQIMYYKSPSDVIRKPQGQMELNSSCQIVRGEG
SQTFQLMTEKRTYFLTADSPNILEEWIHVLQSILRVQVTSPVGVPHSDAKPTVKGWLTKV
KHGHSKLVWCALIGKTFYYYRNHEDKCPLGHLPMRESKVEEVDRSCDSDEDYETTGGGLL
SSHCTLVIHPQDQSPTYLLIRTKQEKDTWLYHLTVAAGSRNATVGTSYEQLIGKLLDAEG
DPNSPLWKHPMLCYSKDGLHMSLTTLPSEALQTEALKLFKSCQLFINVPVEASSIDYHVS
LAQTALQVCLTHTELQNEIFCQLVKQTNCRQPQNHSVIQCWQLLALCAPLFLPQHHFLWY
VKQHLQRHADPRSEIGKYAIYCQRSVDRTVQTGEREAKPSRMEIVSILLRNPYHHSLPFS
IPVHFMNGTYQVVGFDGSSTVDEFIHRLNQETGMRKPSHMGFSLFTDDPSGRDLEHCLQG
NMKICDVISKWEQALKELHPGKYEGGTRIVKLTYKNRLYFRSQAKGETDRERLLLAFQVS
DEIASGRFPVNKELALEMVALMAQQVEYGDLDRTASSSPGGTSHSKMQHLLHQVLDKFYP
KRYKKNIAPELLKQLVDRLATKWMALQGCSPPECVRIYLTVARKWPLFGTKLFAAKPILP
SSLEDCPVWIAVNEDGISVLDYNTMHLKFSYSYSSVLTFGGCRDDFMIVVSQIKERSSGK
NSTEKLLFTMAIPKIVEATLLIATYINSRLTTPLLPSAQPSRSTTPANRLWETESRCFFP
SMPRSTKGPTLL
Download sequence
Identical sequences G1NH72
ENSMGAP00000012503 ENSMGAP00000012503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]