SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012615 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012615
Domain Number 1 Region: 252-513
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.03e-78
Family Protein kinases, catalytic subunit 0.0000000174
Further Details:      
 
Domain Number 2 Region: 109-240
Classification Level Classification E-value
Superfamily SH2 domain 2.26e-29
Family SH2 domain 0.0000222
Further Details:      
 
Domain Number 3 Region: 52-134
Classification Level Classification E-value
Superfamily SH3-domain 1.02e-18
Family SH3-domain 0.0000536
Further Details:      
 
Domain Number 4 Region: 2-38
Classification Level Classification E-value
Superfamily PH domain-like 0.00000787
Family Pleckstrin-homology domain (PH domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012615   Gene: ENSMGAG00000012004   Transcript: ENSMGAT00000013511
Sequence length 523
Comment pep:known_by_projection chromosome:UMD2:4:49274775:49313687:1 gene:ENSMGAG00000012004 transcript:ENSMGAT00000013511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GIKNNSNIMIKYHPKFWTEGIYQCCRQTEKLAPGCEKYNLFENSVVTLPLPMPEKSMRRP
PPPVPPAEENDNEEEEIVVAMYDFQPTERHDLRLDKGEEYTVIEKNDIHWWKARDKHGHE
GYIPSNYVTGKKSNNLDQYEWYSRNLNRSKAEQLLRNEDKEGGFVVRDSSQPGLYTVSLY
TKFGGEGSSGIRHYHIKETVTSPKQYYLAEKHLFNSIPEIIEYHKHNAAGLVTRLRYPVT
PEKTTAPTTAGFSYEKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMY
EEDFIEEAKVMMKLTHPKLVQLYGVCTQQRPIYIVTEFMEHGCLLNYLRQKRGVLSKDVL
LTMCQDVCEGMEYLERNSFIHRDLAARNCLVNDLGVVKVSDFGMTRYVLDDQYTSSSGAK
FPVKWCPPEVFNYSRFSSKSDVWSFGVLMWEVFTEGKMPFEKSSNYDVVTMVSQGHRLYR
PKLACKQVYEVMMMCWQEKPEGRPTFEDLLHIIIDIAEGEDAF
Download sequence
Identical sequences G1NHF9
ENSMGAP00000012615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]