SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012642 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012642
Domain Number 1 Region: 52-240
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.24e-75
Family T-box 0.000000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012642   Gene: ENSMGAG00000012040   Transcript: ENSMGAT00000013538
Sequence length 398
Comment pep:known_by_projection chromosome:UMD2:6:48193151:48224999:1 gene:ENSMGAG00000012040 transcript:ENSMGAT00000013538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQFVEKSSCAQPLSDLSGLEPHGDFSGSPSALCTEPLIPTTPIIPSEEMAKISCSLETKE
LWDKFHELGTEMIITKSGRRMFPTIRVSFSGVDPEAKYIVLMDIVPVDNKRYRYAYHRSS
WLVAGKADPPLPARLYVHPDSPFTGEQLLKQMVSFEKVKLTNNELDQHGHIILNSMHKYQ
PRVHIIKKKDHTASLLNLKSEEFRTFIFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRD
SSRLTDIERESVESLIQKHSYARSPIRTYGGEEDLGDDSQATQSRGSAFTTSDNLSLSSW
VSSSTSFPGFQHPQSLSALGTSTASIATPIPHPIQGSLPPYSRLGMPLTPSAIASSMQGT
GPTFPSFHMPRYHHYFQQGPYAAIQGLRHSSAVMTPFV
Download sequence
Identical sequences G1NHI6
ENSMGAP00000012642 ENSMGAP00000012642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]