SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012658 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012658
Domain Number 1 Region: 771-1018
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.33e-80
Family Eukaryotic proteases 0.0000671
Further Details:      
 
Domain Number 2 Region: 432-553
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.49e-35
Family Frizzled cysteine-rich domain 0.00016
Further Details:      
 
Domain Number 3 Region: 116-231
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 9.55e-31
Family Frizzled cysteine-rich domain 0.00062
Further Details:      
 
Domain Number 4 Region: 633-674
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000012
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 366-406
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 324-362
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000628
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 558-595
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000759
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 249-286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 284-321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 10 Region: 599-631
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000122
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012658   Gene: ENSMGAG00000012044   Transcript: ENSMGAT00000013554
Sequence length 1025
Comment pep:known_by_projection chromosome:UMD2:4:49418509:49527581:1 gene:ENSMGAG00000012044 transcript:ENSMGAT00000013554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLGTDEDNMGDGCSQKLASAKFLRLLLLILIPCICALILSLVILLTFLGLLEKTCFYSNG
SEVLAVNGDIETSSILLPKMAENNSKTHPTVDISTWTPSWTTTSLSQVGQMDTNSSVCIN
MTNSQCQMLPYNYTTLTSVLSIVKSIEMEKFLKFFSYLSRLSCYQHIMLFGCSLALPECI
SNGDDSRVLLPCRTFCEAAKEGCEPVLGMVNASWPEFLKCSQFHNQTENDTTERVCFSPH
QEKGKQSLCGGEESFLCASGICIPGKLQCNGYNDCDDWSDEVHCNCSDDLFHCNTGKCLN
YTFVCDGYDDCGDLSDEQNCVLDCNPMTDHQCGDGRCITADWVCDGDHDCIDKSDEINCS
CHSQGLAECKNGQCIPSAFKCDGDNDCKDGSDEENCNESQTLCQEGDQRCTSCPDPCGTS
ICEMRNSQTNCSQCEPITLELCMNLPYNYTSYPNYLGHRTQKEASVSWESSLFPALVQTN
CYKYLMFFACTVLVPKCDPHTNQRIPPCRTLCVQSKERCESVLGIVGLQWPEDTDCTQFP
DENSDNQTCLTPDEDVEECSPSHFKCRSGRCVLASRRCDGQADCEDDSDEDSCGCRDRGL
WECPLKKLCIKHTMICDGFPDCPDMMDEKNCSFCEKDELECANHECVPRELWCDGQADCS
DSSDEWDCVTLSKNMNSLMFLTIHRSAADNHVCADEWQENLSQLACNQMGLGKKQVTINL
EERKQHQKWLNLHSDWKNKNASTFTCTSSEWVSNRQMCRSRSKVALLCTKEDCGHRPAAR
MNKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKRWVLTVAHCFEGRENAAVWKVV
FGISNLDHPSSFMQTRLVKSIILHPRYNRAVVDYDISIVQLNEDINETSYVRPVCLPSKE
QLVQPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEKCQSYFDMKTITSRMLCAGYESGT
VDSCMGDSGGPLVCEQPAGRWTLFGLTSWGSVCFSKVLGPGVYSNVSHFIDWIEKQIYIH
TFLLN
Download sequence
Identical sequences G1NHJ7
ENSMGAP00000012658 ENSMGAP00000012658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]