SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012724 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012724
Domain Number 1 Region: 12-208
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-51
Family DBL homology domain (DH-domain) 0.0000144
Further Details:      
 
Domain Number 2 Region: 206-324
Classification Level Classification E-value
Superfamily PH domain-like 2.62e-34
Family Pleckstrin-homology domain (PH domain) 0.00058
Further Details:      
 
Domain Number 3 Region: 410-474
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000588
Family SH3-domain 0.0000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012724   Gene: ENSMGAG00000012096   Transcript: ENSMGAT00000013621
Sequence length 486
Comment pep:known_by_projection chromosome:UMD2:7:29272995:29289881:1 gene:ENSMGAG00000012096 transcript:ENSMGAT00000013621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSTPPRNLEEEQKAKAMRGRMFVLNELVQTEKDYVKDLGTVVEGFMKRIEEKGVSEDM
KGKDKIVFGNIHQIYDWHKDFFLAELEKCLQEHDRLAQLFIKHERRLHMYVVYCQNKPRS
EYIVAEYEAYFEEVQQEINQRLTISDFLIKPIQRITKYQLLLKDFLRYSEKAGLECSEIE
KAVELMCLVPKRCNDMMNLGRLQGFEGKLTAQGKLLQQDTFYVTEQDSGVQSRPKERRVF
LFEQIVIFSELLRKGSLTPGYMFKKSIKMNYLVIEENVDNDPCRFALMSRETSERVILQA
ANPEIQQAWVQDINQVLDTQRDFLNALQSPIEYQRKESSTAVLRPQAGRVAQPNSRPYSS
VPVGSEKPLKATSRNPSLPPLKISTSNGSTGYEQPGDKYEQSKTDLGGCNGTSSMVVIKD
YYALKEDEICVNQGEVVQILAINQQNMFLVYQPANDHSPAAEGWIPGNILAPLTKSTADN
SDGSIK
Download sequence
Identical sequences G1NHQ1
ENSMGAP00000012724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]