SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012798 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012798
Domain Number 1 Region: 21-330
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.71e-114
Family Protein prenyltransferases 0.0000000000459
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012798   Gene: ENSMGAG00000012180   Transcript: ENSMGAT00000013696
Sequence length 338
Comment pep:known_by_projection chromosome:UMD2:10:31070682:31080378:1 gene:ENSMGAG00000012180 transcript:ENSMGAT00000013696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NASLVLLQGTPQKDVVIKPDAPSTLLSEKHADYIASYGTKKDDYEYCMSEYLRMSGVYWG
LTAMDLMGQLHRMNKEEILAFIKSCQHECGGISASIGHDPHLLYTLSAVQILILYESLHV
VDVNKIVEYIQSLQKEDGSFAGDKWGEIDTRFSFCAAATLALLGKLDAIDVEKAVEFVLS
CMNFDGGFGCRPGSESHAGQIYCCTGFLAITDQLHQINVDLLGWWLCERQLPSGGLNGRP
EKLPDVCYSWWVLASLKMIGRLHWIDREKLRCFILACQDEETGGFADRPGDMVDPFHTLF
GIAGLSLLGEEQIKAVNPVFCMPEDVLRRINVQPELVS
Download sequence
Identical sequences G1NHW3
ENSMGAP00000012798 ENSMGAP00000012798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]