SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012862 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012862
Domain Number 1 Region: 47-457
Classification Level Classification E-value
Superfamily Ras GEF 1.96e-97
Family Ras GEF 0.00057
Further Details:      
 
Domain Number 2 Region: 518-586
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.94e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0012
Further Details:      
 
Domain Number 3 Region: 452-523
Classification Level Classification E-value
Superfamily EF-hand 0.000000000207
Family Calmodulin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012862   Gene: ENSMGAG00000012221   Transcript: ENSMGAT00000013761
Sequence length 787
Comment pep:known_by_projection chromosome:UMD2:5:31793654:31830998:1 gene:ENSMGAG00000012221 transcript:ENSMGAT00000013761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TYFTIVLSSRQPAHGCSTSPESSLELKQISHCHSHSNLTQVTMVPLGHLAKGATLEDLLE
TCIQSFDLEGNSYQNNQLLKMILTMHQFIISSADMLQKLTFSTYLSALEKKSSVLCVKIC
YFVRYWITEFWIMFKMDSKLSTTMEAFQELVKANGEELHCRLIDTTQINSRDWSRKLTQR
VKANSSKKRKVSLLFDHLEPEELSDHLTYLEFKSFRRISFSDYQSYIVNSCVKENPTMER
SIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIHVAQKLHQLQNFNTLMAVIGGLCHSSI
SRLKETSSCVPHDVIKVFNEMTELLSSYRNYDCYRRAYNECTNFKIPILGVHLKDLISLH
EAMPDYLEDKKINICKLYSLYNHINELIQLQEMPLPLEANMDLVHLLTLSLDLYYTEDEI
YELSYAREPRSHRAAPLTPSRPPVVADWASGVSPKPDPKTVSKHVQRMVDSVFKNYDHDQ
DGYISQEEFEKIAASFPFSFCVMAKDSEGLISRDEITAYFMRASSIYSKLGLGFSHNFQE
TTYLRPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLIVIECKRRHKTSVADSSPTS
ALASSLCTVAVKEQFHGQEEGPFTFPNGVVEHNEDSKDRTIMLMGSSAQKISVRLKPAVV
HKGIQTDSTLLAADVSHKSMEKKEKRILENPYLQPIAPSPRPSPLLSRKKAYVKWENKES
SQKMKEEHHEHHSYKPSYQELERERNILKADNEGLKMQLEQAHKTIESLTIQRRNHVIDN
LQHKDCS
Download sequence
Identical sequences G1NI11
ENSMGAP00000012862 ENSMGAP00000012862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]