SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012908 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012908
Domain Number 1 Region: 526-594,826-1046
Classification Level Classification E-value
Superfamily Ras GEF 9.29e-73
Family Ras GEF 0.0002
Further Details:      
 
Domain Number 2 Region: 134-352
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-40
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 
Domain Number 3 Region: 341-495
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000011
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012908   Gene: ENSMGAG00000012254   Transcript: ENSMGAT00000013808
Sequence length 1054
Comment pep:known_by_projection chromosome:UMD2:12:20510190:20535149:-1 gene:ENSMGAG00000012254 transcript:ENSMGAT00000013808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPQHYFTVNFNHENQKTLELRTEDAKDCDEWVAAIAHASYRTLAMEHEALMQKYLHLLQ
IVETEKTVAKQLRQQIEDGEIEIERLKAEIASLLKDHERIQSVQSSAPSDDDSDIKKIKK
VQSFLRGWLCRRKWKTIIQDYIRSPHADSMRKRNQVVFSMLEAEAEYVQQLHILVNNFLR
PLRMAASSKKPPITHDDVSSIFLNSMFLHQIFYQGLKARISSWPTLVLADLFDILLPMLN
IYQEFVRNHQYSLQILAHCKQNRDFDKLLKHYEAKPDCEERTLETFLTYPMFQIPRYILT
LHELLAHTPHEHVERNSLDYAKSKLEELSRIMHDEVSETENIRKNLAIERMIIEGCEILL
DTSQTFVRQGSLIQVPMSEKGKITRGRLGSLSLRKEGERQCFLFSKHLIICTRGSGGKLH
LTKNGVISLIDCTLIEEQESTDEDAKASGQDIDHLDFKIVVEPKDASSFTVILVASSRQE
KAAWTSDISQCVDNIRCNGLMMNAFEENSKVTVPQMIKSDASLYCDDVDIRFSKTMNSCK
VLQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTTALVVLDKLITIYKKPISAIPA
RSLELLFASSQNTKLLYGEPPKSPRANRKFSSPPPLSITKSSSPSRRRKLSLNIPIITGG
KALDLAALSCSSNGYASMYSSMGPFSKTTLDINKLYVSSSYPNKIPDEGEAAAEKQEEML
PSKQSSDVSVREESDTDPNQSDEAEAETSPTKSPTTPMSIKCKNSSDFSLFSYNNGVVMP
SCRELDSTRSALSATSAFAIATAGANEGTPTKEKYRRMSLASAGFPTDQRNGDKEFVIRR
AATNRVLNVLRHWVSKHSQDFETNEELKYRVISFLEEVIHDPELLTQERKAAANIIRTLT
QEDPGDNQTTLEEVVQMAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWM
KLEKNERTPYIMKNTKHFNDVSNLIASEILRNEELTARVSAIEKWVAVADICRCLHNYNA
VLEITSSLNRSAIFRLKKTWLKVSKQVGTGRAGG
Download sequence
Identical sequences G1NI47
ENSMGAP00000012908 ENSMGAP00000012908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]